Detailed information on CNT30695710


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30575346Oryza sativaOryza barthii38.7812.4394.21432forward

Expression of CNT30695710

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MGICSSKAGEINGVACSICRELGRHWVCI*

>peptide 2 (36 aa)
MHGHVFHETMNPSRRCREEMDRLSLKRLTLTRIKSQ*

>peptide 3 (31 aa)
LIGQNKGIGWRSNMSLMRIGIRIGVLRALET*

>peptide 4 (45 aa)
MEIQYELNADRDPNRSPTGLRDLSDGSYIFARGVTGGGIASREKP*

Sequence

>CNT30695710
GTTTAATTGGCCAGAATAAGGGGATTGGATGGAGATCCAATATGAGCTTAATGCGGATAGGGATCCGAATAGGAGTCCTACGGGCCTTAGAGACCTGAGT
GATGGATCCTATATATTCGCGAGGGGTGTGACCGGCGGAGGTATTGCATCACGTGAGAAACCCTAGTCGTCACTCCCCTCCCCGAGCAAAACCCTAGCCG
CGCGCGGGTGCTAGCACATCTGCGCGTGGCGTTCCATCCCTGTACGTGTGGATACCGGTAGAGGCGCCGCTGGTTTGCGGTGCTGATCAGCGTGGGAATA
CGGCGAGGAGAACGCACGAGGAGGAGAAGGTCAAGCCGGTGCGATCGACTACTTCCTCTACATCGACGCGCGCTACTTCGCGAGAATTCCTTCAACTTCT
TAGCGCCTTCTTCCGCTGCACAGCGCGTCGAGTGCTGTCAACGAGGAGCAGCAGCAGCAGAATGCATGGGCATGTGTTCCATGAAACCATGAATCCGAGC
AGGAGATGCAGAGAAGAGATGGATCGCTTGAGCCTGAAGCGTTTGACGTTGACGCGAATCAAATCTCAGTGAAGTGCAGTTGAGAGAGCTTTGGTCCAAA
ATCGAGATGGGGATTTGTTCTTCCAAAGCTGGGGAGATTAATGGTGTTGCCTGCTCAATTTGCCGGGAATTGGGGAGACATTGGGTTTGCATTTAGTACA
AATCACAAAGCTTTTTGATGAACATTTTGACCTGACTGACACAAGCGCACGGGCGAAGCCTTTTGTCCTCGAGCGATTGGAAGGAGCAAGAACTCTCACC
CCCTGTGCTGAATTCTCGCGTCACTGTCCATGATCCAGTGATCATTTCTTGGATGTTTTTGTTTGTGTGTTTTTGCAGTTAGTAAGATAATTAAGAAACT
ACTTAATTACCAGTTGTCTTGTTCTTCATTTTCATGGATCAGTTTGCAGATGAGATCTCTCTTCAATGAAATTGGTGGCTCACCGATTCGTTAAAAAAAG
TTTATAGATGAGATATTTTTCCCTTTCTCTAGCAGAAAAAAGTTCATTTTGAAATGGACATGTACTTTCCATGAATGTTTGAAACACACCGTGTGTTTGC
ATATAGTAATTGAA