Detailed information on CNT30695700


BLAST search results

BLAST vs Swiss-Prot:
sp|Q84J55|14331_ORYSJ, E-value = 4e-42

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30631409Oryza sativaVigna unguiculata20.0512.3292.0588forward
CNT30589230Oryza sativaMusa acuminata24.623.5390.74108forward
CNT30256914Oryza sativaAvena sativa24.8323.4990.83109forward
CNT30262769Oryza sativaBrassica rapa24.3719.6385.98107forward
CNT30228817Oryza sativaAnanas comosus38.0429.289.82167forward
CNT30117397Oryza sativaOryza nivara37.8129.96100166forward

Expression of CNT30695700

Peptides detected in this lncRNA

>peptide 1 (91 aa)
RGLVGGEGGVGGVLALGSGLELGEVAVVVALHLEVEDLGVDGGVSPRRCWRARPRRGRGRSARRRRGPRRRGLPPSARWRTRCATTPCARR*

>peptide 2 (67 aa)
MEDTMRHDALRAPMTFLYATDSRFLSSTVSSPPPPAAAAVTTFSMNSTISSYLSACSASFAMYTISSL

Sequence

>CNT30695700
GCGCGGCCTGGTAGGCGGCGAGGGTGGCGTCGGCGGCGTCCTTGCGCTCGGCTCCGGTCTTGAACTCGGCGAGGTAGCGGTGGTAGTCGCCCTTCATCTT
GAGGTAGAAGACCTTGGCGTCGACGGCGGAGTATCCCCGCGCAGATGTTGGAGAGCTCGGCCTCGACGCGGGCGCGGTAGGAGCGCGCGGCGGCGGCGTG
GCCCGCGGCGCCGCGGCCTTCCTCCTTCTGCTCGATGGAGGACACGATGCGCCACGACGCCCTGCGCGCGCCGATGACGTTCTTGTACGCCACGGACAGC
AGGTTCCTCTCCTCCACCGTGAGCTCCCCACCCCCGCCCGCCGCCGCCGCCGTCACCACCTTCTCCATGAACTCCACCATCTCCTCGTACCTCTCCGCCT
GCTCCGCCAGCTTCGCCATGTACACCATCTCCTCCCTCG