Detailed information on CNT30695594


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675559Oryza sativaSetaria viridis6.9624.4193.51154forward
CNT30554577Oryza sativaOryza glaberrima12.9230.33100286forward
CNT30149797Oryza sativaBrachypodium distachyon4.4337.6994.998forward
CNT30117337Oryza sativaOryza nivara74.2956.7998.61644forward

Expression of CNT30695594

Peptides detected in this lncRNA

>peptide 1 (31 aa)
DRLHPLELRITGIEHQKYNTSSSSISQQQTT*

>peptide 2 (32 aa)
MRKKSAVQRGSNPIIDTTHPLNACEAVSGLFW*

>peptide 3 (47 aa)
MELVSLENRLRASYDSEAGDIPLSYHLKNMLSQGSKRKLKKTMKFKV*

>peptide 4 (70 aa)
MIMSTWNTPCSLAVEQLLGDDDGVVLHALVEDAVEAGVRAVVLERRHPVRLVERDAAVQDCVLKVVPASI*

>peptide 5 (91 aa)
MKNKKYEKKKTMVEHLDRAQQWRSITNHLLGELDGPGVGVDVGGLEAGESGGAGELPELPLVPLLAAGVVGEHDHVDVEHPLLPRRRAASW*

>peptide 6 (39 aa)
MYFSHSRLWIFICMLTNVLMVCFVKKIIYFRKYVFSTLL*

>peptide 7 (40 aa)
MIGKGSLFAVDSAIDGCGCFSRRKMSSTFSPLFSYSSAVW*

>peptide 8 (45 aa)
MFLLQLLLLLLMCLCLDALPTNQPTCHCNLATKRVQLAWALHRMF*

>peptide 9 (45 aa)
MMTEWFFMPSLKTRLKRASVPWYSNAVIPYALLNGMPPSRTASLR*

Sequence

>CNT30695594
CAGACAGGTTACATCCATTAGAACTCAGAATCACCGGAATTGAACATCAAAAGTACAACACAAGCAGCAGCAGCATCAGCCAGCAGCAAACGACATGATT
ACCCACGCTTTTGGATGAAGAACAAGAAGTACGAGAAGAAGAAGACGATGGTCGAACACCTTGATCGAGCTCAACAATGGCGATCGATCACCAATCACCT
ACTTGGTGAACTCGATGGCCCAGGCGTTGGCGTAGATGTAGGTGGCCTTGAAGCCGGTGAATCCGGCGGCGCGGGCGAGCTCCCTGAACTCCCTCTCGTA
CCTCTCCTTGCCGCCGGGGTTGTGGGCGAGCATGATCATGTCGACGTGGAACACCCCCTGCTCCCTCGCCGTCGAGCAGCTTCTTGGTGATGATGACGGA
GTGGTTCTTCATGCCCTCGTTGAAGACGCGGTTGAAGCGGGCGTCCGTGCCGTGGTACTCGAACGCCGTCATCCCGTACGCCTTGTTGAACGGGATGCCG
CCGTCCAGGACTGCGTCCTTAAGGTAGTACCTGCATCGATATAGATATAGATCGAGTTTACTTTCAAACCTTTTCTTCAAACTTTCAACTTTTCCATCAC
ACATCATTCCAATTTCAACCAAACTTTTAATTTTAGCGTGAACTAAACACAGGCATATGCAACTTCTTCATTTTTATTGTCCATGTACTTTTCTCATTCT
AGATTATGGATTTTTATTTGCATGCTTACCAATGTTCTAATGGTATGTTTTGTAAAAAAAATTATATATTTTAGAAAATATGTTTTTTCAACTTTGTTAT
AGTTACACTTCATTTGTTTATACCTGAAATAGATATAGAAAAATTCCATCAATTTCAACTTAAAAAATGGGGCCTTATTTTTCCTAAAATAAAATATCTT
TTTATGCGCAAAAATAATAATTCTTGGAGTTGAACGGTCTTCATAATGCAACTTTAACCAATAATTTCTAGGGTAATAATGTTGTAGGCGGTCCGATAAA
TTTGTAAAAAGTTGTGAAAACGATTTTGGAGTACAATCCATATTCTGTAAGATATAAGCATATAAAGATTCAGCGGGATAACTATGAGGTCATGAGAAAA
TGAGAAAGAAGTCGGCTGTTCAACGGGGTTCAAATCCTATAATTGACACCACGCATCCATTGAATGCCTGTGAGGCTGTGAGTGGATTGTTTTGGTAGGA
AATTGATGGATGTTCCTCCTCCAGCTGCTGCTGTTGCTACTGATGTGTCTTTGTCTAGACGCACTACCTACTAACCAACCTACATGCCATTGCAATCTTG
CCACTAAAAGGGTACAGCTTGCTTGGGCTTTGCACAGGATGTTCTGAATAATAACTACTGTACTCTTTTTTCTACTTTCTACCTGAATTTCTGAACCCCA
AAATCTTAGAAGAATAATCAAAGGCATGCAGGAAAAGTCACACAAGCTTATTTGATTTCTAGTACTCTGTCCACATCAAACAAACTGGCTATATATACAC
AACACTACCGAATTTTCTACAGGTAGGTGGAGAATCAGTTTGTGACACCAAGCCAGCTGATCAGATCAGCCAAGATTTCTCCATCATGCATTTTGAGCAT
GACATGTTAGGATGATTGGGAAGGGATCTCTATTCGCCGTCGATTCGGCGATCGACGGCTGTGGTTGCTTCTCTAGAAGGAAGATGAGCTCAACCTTTTC
CCCCCTCTTTTCATATTCCTCAGCTGTTTGGTGACCAAGTTTAGTGCTTGCTAGCATCACCCCCCACTACTAGAGGAGGGTCACCAACACCCTTTTCTAA
GTGCACATAATTATGCCGTAGCGGCTATCAGTCGGTGCTATGCGTACGTAAGAACAAATTTTCGTCAGAGAATTAATTTCTTTTCTAGCATATGTATTGA
AAATCGATTACGTGCCTGTCGGTGCTATTTATACGTGTAAGAACGATTTTTCTTCATGGAATTAGTTTCTTTAGAAAATCGATTACGTGCATCATATGAT
TCAGAGGCCGGGGATATTCCTTTATCCTATCATCTAAAAAACATGTTGTCTCAAGGTTCTAAAAGGAAACTAAAAAAAACAATGAAATTCAAGGTTTGAT
ATGCTTGTTGCACCTAACTCCTTTTGAAAATGGAAGTTGGCATAGTGGGTTTTATTTGTGAAGGTTTATGTAGGGGTGGGCCCACATGTCAGCGAGAGAG
GAGGAGACAAAAT