Detailed information on CNT30695577


BLAST search results

BLAST vs Swiss-Prot:
sp|P27521|CA4_ARATH, E-value = 2e-96

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675792Oryza sativaSetaria viridis34.5150.3692.88351forward
CNT30523568Oryza sativaSetaria italica37.7636.4793.49384forward
CNT30300839Oryza sativaTriticum aestivum38.2536.4691.26389forward
CNT30224179Oryza sativaHordeum vulgare11.3127.2592.17115forward
CNT30395365Oryza sativaTriticum turgidum23.386.8190.3237forward
CNT30591239Oryza sativaMusa acuminata18.1966.0786.49185forward
CNT308181Oryza sativaZea mays18.2933.8890.86186forward
CNT30685421Oryza sativaTriticum urartu18.1977.7389.19185forward
CNT30370931Oryza sativaOryza glumipatula44.0525.9699.78448forward
CNT3038035Oryza sativaCucumis melo14.9530.8380.92152forward
CNT30102887Oryza sativaOryza rufipogon69.8184.7399.72710forward
CNT30117373Oryza sativaOryza nivara84.0754.6397.54855forward
CNT30604463Oryza sativaOryza punctata37.5632.5797.12382forward

Expression of CNT30695577

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MASFHCMLLFFSSDILIESYRWRAPSPWPRGWARS*

>peptide 2 (37 aa)
MHTPQKKKEETRREHLPSPNHRFHQPELIKLLEMPWP*

>peptide 3 (48 aa)
MMVLCHGSDRCCSRNPKNASIASLPATTTSTKIQNNGVVSLYAALLFF*

Sequence

>CNT30695577
TGAATCTGTACGGATTTTTTTTTTTTTTTGTCTTTGAATCGATACGCAATACTGAATCAATGCGCAAATGAAGCACTTGACAAGCAATTAAGCGTAGTTT
ATCCACCATAATTAAGATCGAGACCATGAGATAGCTAGAACACTGCTGCTACCATGAGATAGTTTATCCCCCTGAAACAATTACCACAACACACACAGTA
AGTCTGAATCTCATCACATCCATCTCTCTCTCTCTCCTCCCCCCAATTCATTAACATCTTATACATGCATACTCCACAAAAAAAAAAAGAAGAAACAAGA
AGAGAACATCTTCCATCGCCCAATCATCGGTTTCACCAGCCTGAACTCATCAAGCTCCTTGAGATGCCCTGGCCCTGATGAAATCGATCACACGCTCAGC
CTGACAGCGTCTGGATGATGGTGTTGTGCCACGGGTCAGACAGGTGCTGCAGCAGGAACCCCAAGAACGCCAGCATCGCCAGCCTCCCTGCAACAACAAC
ATCAACAAAAATTCAGAACAATGGCGTCGTTTCATTGTATGCTGCTCTTCTTTTCTTCTGATATATTGATAGAATCGTACCGTTGGCGAGCTCCTTCTCC
TTGGCCTCGAGGGTGGGCTCGAAGTTGAGGGGGTTGAAGACGCTGCCGGGGTAGCCGCACTCGTGCGGCGGGAGGCTGTAGCTCTTGAAGATGGGGTCCT
GGTTGACGCAGCCAGGGTTCTTGATGTCCTGCCACCGCCGGATCTCCACGTAGTGGAACAGGATGAACTCGATGACGAACAGCGTCGACGACGACGCGAA
GTAGGTGGCCTTGCCGGCGTCGTACCACTGCGGCGCGTCGATCAACCCGATCTTCGTCAGCACCTCAGGCAGCAGCATCCCGGCCACCCCCAGCATCGCC
CACCGCCCGTTCACCAGCTCCGCCTGCACGAACCACCGCAGGTTCTCCGGGTCCTCCGCCAGACCCAACGGGTCGAACCCGTTATCGCCTGGCAAGCTGT
ACACACCCGTTTAACTA