Detailed information on CNT30695521


BLAST search results

BLAST vs Swiss-Prot:
sp|P36213|PSAD_HORVU, E-value = 5e-101

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678303Oryza sativaSetaria viridis25.4654.7893.85195forward
CNT30639185Oryza sativaNymphaea colorata40.4772.683.87310forward
CNT30515273Oryza sativaJuglans regia36.2943.3780.22278forward
CNT30630495Oryza sativaVigna unguiculata39.0352.7381.61299forward
CNT30710333Oryza sativaGlycine max41.3836.4482.65317forward
CNT30395090Oryza sativaTriticum turgidum58.0941.492.13445forward
CNT3089114Oryza sativaVigna radiata35.7728.4881.75274forward
CNT30554655Oryza sativaOryza glaberrima60.0552.57100460forward
CNT30440464Oryza sativaAegilops tauschii58.0953.6192.58445forward
CNT30246994Oryza sativaAvena sativa55.6151.0292.96426forward
CNT30665756Oryza sativaTriticum dicoccoides47.6551.4192.88365forward
CNT30446699Oryza sativaSaccharum spontaneum33.1628.3292.52254forward
CNT30971Oryza sativaZea mays38.6451.9392.23296forward
CNT30651308Oryza sativaRosa chinensis22.5830.0380.35173forward
CNT30344027Oryza sativaEragrostis tef52.3549.6393.52401forward
CNT30361538Oryza sativaSorghum bicolor34.9955.2692.16268forward
CNT30619829Oryza sativaCajanus cajan41.3832.1584.23317forward
CNT30596794Oryza sativaOryza meridionalis38.5144.4999.66295forward
CNT30356274Oryza sativaLactuca sativa41.5148.7778.93318forward
CNT30370923Oryza sativaOryza glumipatula72.1965.699.82553forward
CNT30570681Oryza sativaVitis vinifera20.2311.3485.81155forward
CNT30148662Oryza sativaBrachypodium distachyon41.5141.390.57318forward
CNT30577354Oryza sativaOryza barthii74.869.7196.34573forward
CNT30579362Oryza sativaEchinochloa crusgalli56.449.5493.52432forward
CNT30174623Oryza sativaVigna angularis33.8130.481.08259forward
CNT30113105Oryza sativaFicus carica41.2539.587.34316forward
CNT3049718Oryza sativaCucumis sativus25.236.9780.83193forward

Expression of CNT30695521

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MSKTFLPVNLTSMGLTFLPMLRKFWPTPCLPALTFSG*

>peptide 2 (37 aa)
TIINTLMNTHQNSPNIYYNIIRRDYIPPSIDYTIINN*

Sequence

>CNT30695521
CACAATAATTAACACGTTAATGAACACGCATCAAAATTCACCAAACATATACTACAATATTATAAGAAGAGATTATATCCCACCATCGATCGATTACACC
ATCATCAATAACTGAAGAGCAGCCTGACAGATGATTAAAATTACATGTCCATCCACCCAAAACACAAGTAATTAATAGGTCGATTATGAGAGAAGAAGAA
GAAGAAGAAGAAGTCTAGATGTCGAAGACGTTCTTGCCGGTGAACTTGACCTCGATGGGGCTGACGTTCTTGCCGATGCTGCGGAAGTTCTGGCCGACGC
CCTGCCTGCCGGCGTTGACCTTCTCCGGGTAGACGCCGTCCTTGGGGTGGAGGTACTGCACCTCGCCATTGGGGAAGACGCGGTAGAACTGGTAGTTGAT
CTTGTACTTGGAGCGGAGCCTGGTGCCCAGGGCCAGGCACTGCTCCTTCCTGGCCAGCTTCAGCAGGTTGGGGCCCTCGCGCATGATGGCGGCGCCGCCC
GTGGGCATCTCGAACACCTGCTCCTTGGGCGACGTCCATGTGATGACGTAGAACTCCTCCACCTGCGCCTTCCGGAGGAGTCCCCCCGTGCTCCCGCCGA
AGATCGGGGACGGCGTGTTGGGGTCCAGCTGCGGCGGCACGAACCCCGCGGGGGCTGGCTTCTTCTCCTCCGTGGCACTTGGCGGCGGAGGCTTGCGTGG
CCATGGCCATGGTGGTCGGAGGAGGAGAGAGGAGGGTACCGTGTGGTGGATTCGATTCGAGTGGTG