Detailed information on CNT30695405


BLAST search results

BLAST vs Swiss-Prot:
sp|P36213|PSAD_HORVU, E-value = 1e-48

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30695405

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MSKTFLPVNLTSMGLTFLPMLRKFWPTPCLPALGPSRMMAAPPVGISNTCSLGDVHVMT*

>peptide 2 (39 aa)
MAGRDFDTRPPHMHVTVALAPPSLSDVASVSVSFFGAIPS

>peptide 3 (32 aa)
MAMVVGGGERRVPCGGFDSSGVVWRREISEME*

Sequence

>CNT30695405
ATCCCACCATCGATCGATTACACCATCATCAATAACTGAAGAGCAGCCTGACAGATGATTAAAATTACATGTCCATCCACCCAAAACACAAGTAATTAAT
AGGTCGATTATGAGAGAAGAAGAAGAAGAAGAAGAAGTCTAGATGTCGAAGACGTTCTTGCCGGTGAACTTGACCTCGATGGGGCTGACGTTCTTGCCGA
TGCTGCGGAAGTTCTGGCCGACGCCCTGCCTGCCGGCGTTGGGGCCCTCGCGCATGATGGCGGCGCCGCCCGTGGGCATCTCGAACACCTGCTCCTTGGG
CGACGTCCATGTGATGACGTAGAACTCCTCCACCTGCGCCTTCCGGAGGAGTCCCCCCGTGCTCCCGCCGAAGATCGGGGACGGCGTGTTGGGGTCCAGC
TGCGGCGGCACGAACCCCGCGGGGGCTGGCTTCTTCTCCTCCGTCGCCGCCGCGGCGGGCTGATCCTCCGCCGCCGCTCTGAGGGAGGTGGCACTTGGCG
GCGGAGGCTTGCGTGGCCATGGCCATGGTGGTCGGAGGAGGAGAGAGGAGGGTACCGTGTGGTGGATTCGATTCGAGTGGTGTGGTGTGGAGGAGAGAGA
TATCGGAGATGGAGTAAGAAGAAGAGAGGGGAAATGGGTGAGGAAGTGGATAAGGGGATATGAGGTTGGCCAATGGCGGGTAGGGATTTTGATACGCGGC
CTCCACACATGCATGTCACCGTGGCACTGGCCCCTCCCTCCCTATCTGATGTGGCATCTGTCAGTGTGTCGTTCTTCGGCGCTATACCCTCGTG