Detailed information on CNT30695228


BLAST search results

BLAST vs Swiss-Prot:
sp|A0A0P0XBU0|CCA1_ORYSJ, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675881Oryza sativaSetaria viridis47.6644.1282.75458forward
CNT30523672Oryza sativaSetaria italica43.643.2481.38419forward
CNT30366549Oryza sativaSorghum bicolor23.131.7180.63222forward
CNT30103059Oryza sativaOryza rufipogon28.285.22100271forward
CNT30577520Oryza sativaOryza barthii23.230.8999.55223forward
CNT30497933Oryza sativaDigitaria exilis30.0727.1684.78289forward
CNT30117398Oryza sativaOryza nivara33.9257.0999.69326forward

Expression of CNT30695228

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MPCWEESQRGFLEHSQKDFLDLDQEYCRLL*

>peptide 2 (41 aa)
MDALIHSSAGSSHLITCLIRMASFSSSGLKASNPISVHLVV*

>peptide 3 (46 aa)
MRMIRLRADVYPIEPFHFLIIDIFCILPCTIGNRIPFQDDHIFDFCF

>peptide 4 (57 aa)
ALSAGDIFNSVWSDTSPFPLSSVSEDTMTFIASKLSCFRVSCNSFCALSIGQSISFS*

>peptide 5 (68 aa)
MLQAWQLHGLQGLTTMWMTYWQKICRHLGCSGIASLVQRLHSCEERAVLRHCRRILDPQEVLDGCIDS*

Sequence

>CNT30695228
GCCTTATCTGCTGGAGATATCTTTAACTCAGTGTGGAGCGACACTTCTCCTTTTCCACTCTCATCAGTCTCTGAAGACACTATGACCTTCATAGCTTCAA
AATTATCTTGTTTCCGAGTTTCTTGCAATTCCTTCTGTGCATTATCCATTGGGCAGTCTATATCTTTCTCTTGAGCTCGCTGAACATCTGCTGTGGAAAA
GGGAGCACTAGGAGCTGGAACAAATGGAAAAGCTATAGGTGGAGGAAAAAGAGGGAGAAGACCTTGTGTTGCCCACCATGCTGATGCTGCAGCAACTGTA
GCTGTGACAATAGATGCCATGTTGGGAGGAGAGCCAGCGTGGCTTCCTTGAGCACTCTCAGAAAGATTTTCTTGATTTGGATCAGGAGTATTGCCGTCTA
CTGTAGGCCAGTACGATGCTGCAAGCCTGGCAGCTGCATGGATTGCAGGGTTTGACAACAATGTGGATGACATATTGGCAAAAGATCTGTAGGCATCTTG
GTTGCAGTGGCATTGCATCATTGGTGCAAAGGCTGCATAGTTGTGAGGAAAGGGCTGTGCTGCGGCATTGCCGTCGAATTTTGGATCCACAGGAAGTGTT
GGATGGATGCATTGATTCATAGTTCCGCTGGCTCCTCCCATTTGATCACTTGTTTGATCAGGATGGCTTCCTTCAGTTCCAGTGGCTTGAAAGCCAGTAA
CCCCATTTCTGTCCATTTGGTAGTGTGAAGCTTTTGCAGCAGACCAATCCACATATGTTGTCTCCACAGAGTTTGATTTTGGCTTAAATTGTTGGCTTGA
GGTATCCAAACAGTTTTCATGAGAATGATCAGGCTTCGAGCTGATGTGTATCCCATTGAGCCTTTCCATTTCTTGATCATTGATATCTTTTGCATCCTTC
CCTGCACCATTGGAAATAGAATCCCTTTCCAAGATGACCACATCTTTGACTTCTGTTTTAG