Detailed information on CNT30695212


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0J8M2|FER1_ORYSJ, E-value = 3e-53

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30192541Oryza sativaSecale cereale2417.2890.48168forward
CNT30308049Oryza sativaTriticum aestivum2425.3491.07168forward
CNT30226851Oryza sativaHordeum vulgare23.8624.8591.02167forward
CNT30400520Oryza sativaTriticum turgidum23.8622.6690.42167forward
CNT30443354Oryza sativaAegilops tauschii2427.3285.12168forward
CNT30670383Oryza sativaTriticum dicoccoides23.8656.4291.02167forward
CNT30141331Oryza sativaLolium perenne2424.683.33168forward
CNT30683915Oryza sativaTriticum urartu2419.8191.07168forward
CNT30596773Oryza sativaOryza meridionalis8994.5493.58623forward
CNT30370840Oryza sativaOryza glumipatula99.7196.94100698forward
CNT30102906Oryza sativaOryza rufipogon8879.2898.21616forward
CNT30117414Oryza sativaOryza nivara10082.6499.71700forward
CNT30551485Oryza sativaOryza brachyantha33.1429.8292.24232forward

Expression of CNT30695212

Peptides detected in this lncRNA

>peptide 1 (44 aa)
LLINCSFKYMEYVFDSSIYDTVMHAYMTPKCDMDMIKQVQQNVH*

>peptide 2 (72 aa)
MYTSSGTCSSTSPSGVISFTLYVACIRSLSPSLLLAGSTDTRAGAGAVATRRDIGNRTWLLSAVAAMAAIAN*

Sequence

>CNT30695212
GCTTATTAATTAACTGTTCTTTCAAATACATGGAGTACGTATTTGACAGTAGTATATATGACACAGTAATGCATGCATATATGACACCAAAATGTGATAT
GGATATGATTAAGCAGGTGCAGCAAAACGTACATTAATTAAACAACAACAATTAACCCTCGGGCACGCCTGTGTTTTGTTATCTCGCTCAACATATACGT
ACGTAATACTTTGCTTGCATAGCATAGGGACGACGACATTATATTCTTAATTGATAAACTCAAGAACGCATGGAGATGGATCGAGAGATTTATAAATATG
GAGCTTGCTTGATTGATTAGATGAGGTCGTCCTCCTTGTGGGTCTCGATGACGACGTCGGACTTGGGGTAGGCGTGGCAGGAGTAAGGCAGGTCGATCCC
TTCCTCCTCCGCCTGGTCCAGGATGTACACGTCGTCCGGCACCTGCAGCTCCACCTCGCCGTCCGGTGTGATCAGCTTCACGTTGTACGTCGCCTGCATC
CGCAGCCTGTCTCCCAGCTTGTTGCTCGCCGGCAGCACCGACACGCGCGCCGGCGCCGGCGCCGTCGCCACCCGCAGGGACATCGGCAACCGGACCTGGC
TGCTCAGTGCCGTCGCCGCCATGGCTGCTATAGCTAATTAAGCTAGCTAGCTGCTGCTGCTAGGTAAGGTAGACGAGGAGGAGAGGAGTGAGCTAGCAAG