Detailed information on CNT30695053


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554442Oryza sativaOryza glaberrima31.1442.1597.85279forward
CNT30596602Oryza sativaOryza meridionalis19.3135.3196.53173forward
CNT30102719Oryza sativaOryza rufipogon31.1439.897.85279forward
CNT30117172Oryza sativaOryza nivara31.1441.3997.85279forward

Expression of CNT30695053

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MAIAQSSNVVGRVVKPKPKLRSLLLLPPVP*

Sequence

>CNT30695053
AGAAAAAAGATGACAGATCTATGATCCGGGCAAAGATGGAATAATACAATGAATCAATGATGATGATGACAGCAACATAAAATAAATTAAAAGTAGATGA
TCTCAGTGGTACAGTACAAGGGCGGGCAGGCAGCAGCTAGCAGAGTCATATCGTGGGCGTAGCAGAGAGAAGAAGAAGAAGAAGAAAGAAACAAAAGAAT
CCGAGGCATGGCGATCGCTCAATCATCAAATGTGGTTGGGAGAGTGGTAAAGCCAAAGCCAAAGCTAAGGTCCCTCCTCCTCCTCCCTCCCGTCCCGTAA
AAGAATCGACGAGCAAAATACAGCGCAAAATGTGGTGGGGCGCACCGGCCGCTGCCATCTGCGTCGTCGTCGTTGCTCACGTCGTTGCACGACGCCGTTT
TGCTTAGGCGAGGAGGGCGACGAGGCGGCGGGGGCCTTAGCCTTCTTGGAGTGCTTGGGGGACTCGGCGACGCGACGGGAGCCTCGACCGGGGGAGACGA
GGCCGGCGGCGGGGTGGCCTTGGCCGCCTTGGGCGCCGGGGCGGGTGCCTTGGTGGACTTGGTGGGTGGCGCTTTGGTCGGAGCCGGGGTGGTGGGCGCC
TCGGCGGGGGCCGGGGTGGCGGGGGTGGTCGGCGCCGCGGCGGGCGGGGTGGAGGCGGCGGGCGGGGTGGTGGTGGTGGGCGCCGCGGCGGGCGCGGGCG
TCTTCTTGGAGGAGGCCGGTGGCGTGGTGGCCGGCGCCGCGGCGGGGGTGGGGGTCGCCTTCTGCGCGGACGCGGACGCCGCGACGAGGCAGAGCAGCGC
GAGGCAGAGTGCGGCTGCGCGCGCCATTGCGGCGGTGGTGGTTTGCTCGGCTCGGTGCGGCGACGGTGGTGGTGGTGGTGGTGGTGGGGAGGAAGC