Detailed information on CNT30694998


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673818Oryza sativaSetaria viridis22.6934.1292.31130forward
CNT30521507Oryza sativaSetaria italica22.6932.9992.31130forward
CNT30290454Oryza sativaTriticum aestivum22.6960.1989.23130forward
CNT30387265Oryza sativaTriticum turgidum22.6923.0589.23130forward
CNT30560151Oryza sativaActinidia chinensis21.299.7382.79122forward
CNT30554351Oryza sativaOryza glaberrima58.8150.3799.7337forward
CNT30244221Oryza sativaAvena sativa22.6925.6490.77130forward
CNT30133222Oryza sativaLolium perenne22.6914.3690.77130forward
CNT30610134Oryza sativaGossypium raimondii21.2951.4884.43122forward
CNT30680882Oryza sativaTriticum urartu22.6937.989.23130forward
CNT30576990Oryza sativaOryza barthii56.5454.82100324forward
CNT30583062Oryza sativaEchinochloa crusgalli22.6916.7389.23130forward
CNT30117183Oryza sativaOryza nivara10084.7699.65573forward
CNT30557390Oryza sativaPanicum hallii22.6919.1293.08130forward

Expression of CNT30694998

Peptides detected in this lncRNA

>peptide 1 (43 aa)
ITENQSLHAGEIDGSTSLLNLFLILMYNQRNTHAHTHACTASL*

>peptide 2 (92 aa)
MYSLPSLTVAVISWWVRVAGDGEATRAATRAVDWWRKQEVDAIAGRWAGASPLIACLRVERGVVWWRERVMGRGGDGITKRRAQWGRGGGEDL

Sequence

>CNT30694998
GGATCACAGAAAATCAATCCTTGCATGCAGGGGAAATCGATGGATCGACCTCTCTCCTTAACTTGTTCTTAATTCTCATGTACAATCAAAGAAACACACA
CGCACACACACATGCGTGCACTGCATCTCTCTGAGCAACGAACTCGATTGATTTGATTTTGATTCGCTAGGGATTAAAGAGAAGCTGAGATAGAGATTTC
GACGATCATGCGACGCTGAAGGAGCTGGCTGCGCTCTCGACGAACTTCCTGGCGCCCTTGAACCACCTCTTGTCGCCGGCCTGCGCCTTGCAGATGTACA
GCTTGCCGTCGTTGACGGTGGCCGTGATCAGCTGGTGGGTCCGTGTCGCCGGGGACGGGGAGGCGACGCGCGCGGCGACGCGGGCCGTGGACTGGTGGAG
GAAGCAGGAGGTGGACGCCATTGCCGGCCGGTGGGCTGGTGCCTCGCCGCTGATTGCCTGCCTGAGAGTGGAGCGGGGTGTAGTGTGGTGGAGGGAGAGG
GTGATGGGGCGAGGTGGCGACGGGATAACGAAGAGGAGAGCGCAGTGGGGGCGCGGCGGTGGCGAGGACTTGT