Detailed information on CNT30694821


BLAST search results

BLAST vs Swiss-Prot:
sp|P0C1M0|ATPG_MAIZE, E-value = 5e-147

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671983Oryza sativaSetaria viridis29.0766.495.83336forward
CNT30520196Oryza sativaSetaria italica32.6146.1495.76377forward
CNT30289322Oryza sativaTriticum aestivum7.7925.079090forward
CNT30221396Oryza sativaHordeum vulgare32.3531.5990.64374forward
CNT30554409Oryza sativaOryza glaberrima53.4644.0299.35618forward
CNT30243325Oryza sativaAvena sativa32.3555.4191.18374forward
CNT30659962Oryza sativaTriticum dicoccoides19.0356.4190.91220forward
CNT30453817Oryza sativaSaccharum spontaneum32.5335.5792.29376forward
CNT3012827Oryza sativaZea mays25.5218.2891.19295forward
CNT30229753Oryza sativaAnanas comosus15.9229.1682.07184forward
CNT30720275Oryza sativaTriticum spelta32.3559.1891.18374forward
CNT30363035Oryza sativaSorghum bicolor32.7953.7693.93379forward
CNT30596670Oryza sativaOryza meridionalis21.2840.5997.56246forward
CNT30102695Oryza sativaOryza rufipogon83.8293.9100969forward
CNT30577158Oryza sativaOryza barthii53.4643.7799.35618forward
CNT30117211Oryza sativaOryza nivara43.6942.899.6505forward

Expression of CNT30694821

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MRLRSSRSEHRTTCRRPLLPQLGAERRRVARAEEDQAVERCEHDMAGGSPATAAAAAAASGGKDFGLGLGGGEAR

>peptide 2 (29 aa)
RIDLFSFFFSCYHRNYRHNSKREKGSKKE*

>peptide 3 (30 aa)
MSQMDWESFTVGMPFTSSVRSVGMKGRRMK*

>peptide 4 (40 aa)
MERFFRSSMALSVALLMALILAASSLASDSWSARRIWLLR*

>peptide 5 (48 aa)
VGSIFFPFFFRAITEITDTIAREKKEVKKNRVVYITAATSAAQARWMG*

Sequence

>CNT30694821
GTCGGATCGATCTTTTTTCCTTTTTTTTTTCGTGCTATCACAGAAATTACAGACACAATAGCAAGAGAGAAAAAGGAAGTAAAAAAGAATAGAGTAGTAT
ATATAACAGCAGCAACCTCAGCAGCTCAAGCGAGGTGGATGGGATGAAGAAATGAGTTGATTGGATTTAGGCGAGGGCGTCGGCGCCGGCGACGATCTCG
AGGATCTCGCCGGTGATCTTGGCCTGGCGCTGGCGGTTGTAGACCATGGAGAGGTTCTTCCGGAGCTCGATGGCGTTGTCGGTGGCGCTGCTCATGGCGC
TCATCCTGGCGGCGAGCTCGCTGGCGAGCGACTCCTGGAGCGCGCGGAGGATCTGGCTGTTGAGGTAGAGCGGGAGGAGCGCGTCGAGGATCTGGACGGG
GTCCTGCTCGAACTGCACCACGGGTGAGAAGGGCTGCGTCTCGATCTTCACCTTCTCCCGCTCCACGGTCAGCTTCCCTTCCTTGGTGGTGAGCCGGAAC
AGCTCGTCCTCGGTGGCGTCCACGCACACGCCGTTGATGTCGCAGATGGACTGGGAGTCCTTCACGGTGGGGATGCCGTTCACCTCCAGCGTCCGCTCGG
TGGGGATGAAGGGGCGGCGGATGAAGTAGGCGTTGCCCTTCTTGCCGACGCTGACGACGGTGTACTCGAGGACGTTGTTGTTGAAGCTGCCGCAGAGGCC
GCGCTCGCCGGTGAGGACGACGAGGGCGACCTTCTTGACGGGGCGGATGCGGGTGAGGGGGAGGTCGATGTCCTCCGTCTGGATCTCCTGGTTCATGTTG
TAGAGCACCTCCACCAGCGCCTCCGAGAAGGGGCGGGAGGACACCACCGCCTCCTGCGCCCGCCGCACCTTGGCCGCCGCCACCAGCTTCATCGCCTCCG
TGATCTTCTGCGTGTTGCGCACCGAGTCGATGCGGCTCCGCAGCTCACGCAGCGAGCACCGCACCACCTGCAGGCGGCCGCTGCTGCCGCAGCTAGGAGC
GGAGCGGCGGCGGGTGGCCAGGGCGGAGGAGGACCAGGCGGTGGAGAGGTGCGAGCACGACATGGCTGGCGGGTCACCGGCAACAGCGGCGGCGGCGGCG
GCGGCGAGTGGAGGGAAAGATTTCGGATTGGGTTTGGGTGGAGGTGAGGCGAGGCG