Detailed information on CNT30694732


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30370776Oryza sativaOryza glumipatula41.8168.5297.58579forward
CNT30102528Oryza sativaOryza rufipogon69.2491.8699.69959forward
CNT30577075Oryza sativaOryza barthii22.4540.2397.43311forward
CNT30117109Oryza sativaOryza nivara45.2786.9698.56627forward

Expression of CNT30694732

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MVTWGVTAANDSINTMLVLGLIRDTSSVSYYKTF*

>peptide 2 (30 aa)
MNVGNARKSYNMKWREYLSFQCFSIYEILL*

>peptide 3 (69 aa)
MMLCNLNCLTFEYTIMHESSRRKEYLFVHHVQTTMKLDTFILKLLLAWMLVIHLDMLRPLTHCFGNLNC*

Sequence

>CNT30694732
AGGCGATCAGGAACCGTGAACACGTAGAGCTCGCCGAGTAGTGCAAAATAGACTATAAGTTTATAGTAATCGGAGTCCGAACAAAGTCCCGGTGACCGAA
TTAATGTGGGCCGTTCGATCTTCATTAGCCTTTCTCTATTTAACCAACAGAAGAAAAAAAAAGAAAGGAAAAAAAAAGTATCGCTAGCAGCCAGCCCTAA
CCGCTCCTGCGCGCTTGCCGCCGCCGCCGTCGTCCTGGTTGCCGCCGCCGTCTTTGCATCGCCGCCACGACCATAGCCGGAGACCACAGCCGTGGTCATC
CATCACAACCGGTGTTTCCTTTCTTTCTTCCCGAGAGAAGGGTACAGAGAGGTTGTACAGGAGGAAGAAGGAAAGGAAAAGGCAGAGCAACGTTGAGAAA
TTTCAGCGATTTCTCAAATTAGAGAAATTTGTCGCAAGGTGTGGAGGGTTCCAACGTTGGAGGAGTTAAGTCGGAGTATCGAAGGAGTTAAGGTACCTAA
TGATATTGATCGGCATGGGACAGGAGTAGCACCCTTGGACTACACATTATTATTGCACACTACTGAAATTTAGTTTTAGACTATGTTTCTGCCTAGCATA
AGTTTTGTGTAGAACTTGTAAAGGTCATTTAAAGTTCCGGTCCATAGTTTCACGGGGAATTCATGGAGCTAGGATGGTTTGGATTGTGTGGGTTATATCG
TTATTGAGTATCTTATAACTGCCTGTCGTGGATGTCCGTATTTTTAGGGGAGACTCTACCGAAATTTCTAATAATTTTGGGAGTTAGTGGTTTTTAGTGT
TTTTGGTGTGGCACTCTAGGTACATGGTTACCTGGGGTGTTACAGCGGCAAATGATTCTATTAATACAATGCTAGTCCTAGGCCTAATAAGAGATACTTC
CTCCGTTTCGTATTATAAGACTTTCTAGCATTGCTCACATTCATATATATGTTAATGAATCTAGGCATATATATGTGTTTAGATTCATTACCATCTATAT
GAATGTGGGCAATGCTAGAAAGTCTTATAATATGAAATGGAGGGAGTATCTATCTTTTCAATGTTTTTCCATCTATGAGATTCTACTATAAAGAAGACTG
CACGAGGGAAAGGCAAAAAATGAATGATGTTATGTAATCTTAATTGTTTGACTTTTGAATACACGATTATGCATGAGAGTAGTAGAAGGAAAGAATATCT
TTTTGTGCATCATGTCCAGACGACCATGAAACTTGATACTTTTATACTCAAATTGTTGTTGGCCTGGATGCTTGTGATTCACTTGGATATGCTAAGACCC
TTAACTCATTGCTTTGGTAATCTTAATTGTTGATTTGTTATTGATCTGGATGTTGTTGCTGAAAATTTTTCATTATGAGTACATA