Detailed information on CNT30694683


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002868, E-value = 1e-81

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30694683

Peptides detected in this lncRNA

>peptide 1 (51 aa)
HKLSNKYSWAPKFLLDQRLGPFEVDAIRRPESESKTCKTLSLVFYGPKVTW*

Sequence

>CNT30694683
CCATAAGCTTTCCAACAAGTACTCATGGGCCCCGAAATTCCTTCTAGATCAGCGGCTAGGTCCGTTTGAAGTTGATGCTATCAGGAGGCCTGAATCCGAA
TCCAAAACGTGTAAAACTTTATCTCTTGTCTTCTATGGACCAAAAGTGACGTGGTGAGGTAGAAGTATACTTGGAGAAGGTCTTGGTTTGGTCCCCAATC
AAC