Detailed information on CNT30694650


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT001125, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553269Oryza sativaOryza glaberrima75.3877.1985.081381forward
CNT30596363Oryza sativaOryza meridionalis55.2999.894.671013reverse complement
CNT30371142Oryza sativaOryza glumipatula66.3890.2795.391216forward
CNT30109162Oryza sativaOryza longistaminata74.8979.2696.651372forward
CNT30102110Oryza sativaOryza rufipogon70.4162.3594.881290forward
CNT30576376Oryza sativaOryza barthii64.0844.195.321174reverse complement

Expression of CNT30694650

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MTKLMIIGKSWTAGKAYIYCSMNILESIRIAVLTD*

>peptide 2 (45 aa)
MVFRESDNQVAYVGFIALEQGKLLFLPFEHKCPVFYISILCISHS*

>peptide 3 (48 aa)
SLFLSHVRPWSPPPDLPHRSFASQTIAPSSSPRRGDSIFPVFPFPPTP*

>peptide 4 (35 aa)
LSLSLPCPAMVATTRSPSPELRKPNHRAIEFASTR*

>peptide 5 (40 aa)
MLDLLRWSKASYYSSPLNINVLYSIFLFYALVIHDLECII*

>peptide 6 (62 aa)
MGTDLDIMLINNVVPLYSGSYVSPREGGKYMPRRANVIFTEAQVNILIIARCVCEFMRTWLR*

>peptide 7 (64 aa)
SLSFSPMSGHGRHHPISLTGASQAKPSRHRVRLDEVIPFFPFSPSPPLHSNHHRHLSLPPKTSS*

Sequence

>CNT30694650
TCTCTCTCTTTCTCTCCCATGTCCGGCCATGGTCGCCACCACCCGATCTCCCTCACCGGAGCTTCGCAAGCCAAACCATCGCGCCATCGAGTTCGCCTCG
ACGAGGTGATTCCATTTTTCCCGTTTTCCCCTTCCCCCCCACTCCATAGCAACCACCACCGCCACCTCTCTTTGCCGCCGAAGACAAGCTCTTGACTGCG
CCGTTCCGGCCAACTCCTTCACTCTCTCCGCCAGCCACCGCCCTCCCCGGGTGTGTCTTGCTCGGGAACACGCGTGGACGCCGACGTCGCCGCCCTCCAG
CCACCGGAGCGCCGCCGCCCCGCTCGCCTTCTCCTCTCTCTTCTCTCGGCTCTCTCTCTGGAACAGAGAAGAGAAGAAGAAGAAGACGAGAGAAGGAGAG
AGAAAAAGAAAAGGAGATCGACAGTAGAGTCTATTGTCTTTTGGATGGCAACCTATGGTATTTCGAGAATCGGATAATCAGGTTGCCTATGTTGGATTTA
TTGCGTTGGAGCAAGGCAAGTTATTATTCCTCCCCTTTGAACATAAATGTCCTGTATTCTATATTTCTATTCTATGCATTAGTCATTCATGATTTGGAAT
GCATAATCTAAACATATAGCAAATCGGTTATATGCTAGCTTTTGCTTAGCCCTGCCTAGTTAGACTGCATAAAACATAATGAACTTAGATTGGGACAGTA
CGTAAGATTTGGTTGATTTCCGGGTGGCTAGTACTGTCTCGGTCGATATAAGTTTACCAAGTACTTATGTCAAACGAACGAGTACGACCGCAGCTTCTAG
AATGGGGACAGACCTAGATATTATGTTAATTAACAATGTGGTACCTCTGTACAGTGGTTCTTATGTAAGTCCTCGCGAAGGAGGCAAATATATGCCGCGA
AGGGCAAATGTGATATTTACCGAGGCGCAGGTAAATATCTTGATTATCGCGCGATGTGTGTGTGAATTTATGAGAACCTGGTTGAGATGACGTGGGGTCT
CTCATCCAGTTCTCTCTAAAAACCCTGGGAACGCCAGAACTTCTCTCGCTGCTGATAACGTTACTTTCAGAGCGCATGGGGACTAGAGTTCATGGAACAG
GTGCCACAATTGTTAACAACATAATACTGGGCCATGACTAAGCTAATGATTATTGGCAAGTCGTGGACTGCGGGTAAAGCGTACATCTACTGCAGTATGA
ATATCCTTGAATCTATTCGAATAGCCGTGCTTACGGATTGAGCATCGGGACTCATATGGTACTTTGGTTAGAAATATAATTCAAGATTTTCTTAAATACT
GTTGCATATCAAACATTTCAGGAGTTCTACCTCTTTATTCTCAGCCTTCTGCAAGTAAATCTAGCTCTACACAGATATTACCTCTCATGCATTCATTGTT
GAATAATATAATAGCTTGCTGAGTACGTTGTACTCACCCTTGCTTCAACCCCTCTTTTTCAGAGTTTAATTGGAGTTTTTGCCGAAGCTGGGAGTTCAAT
CACATAAGTTAGTTCCCTTTAAACCTAGTCTTCAAGTCTAGTAGTATAGTTAGATGGTTTAATTCTATAGTAAAACGACAGAGTTGAGTCATCATATAGC
TTCTGCTGTAATAGTTAGCCACAAACTTGTAAATGTCCTATTATTTTATATAAAGATATCTCCTTTGGAGTCTTTACCAAATGTATGCGATGAAGATCTA
GATTGTTGAACCTGTATCAATCTACTGATCCAGGGCTTGAAACAGTTAAACATGTCGGTTTCCGAATCATTAGTTTTGGGAGCCGACAATTATCACCCGG
GAAAGGCTAATGTTGTAGCAGATGCTCTCAGC