Detailed information on CNT30694591


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT002308, E-value = 5e-123

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102357Oryza sativaOryza rufipogon31.1942.72100446forward

Expression of CNT30694591

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MLCLVPPAACLRCSEPRPAAPTTPPSSRCRAARRPPLPLR*

>peptide 2 (30 aa)
MFYRLQINMHVLLITWDPGITYLLACTMFT*

>peptide 3 (47 aa)
MEPPRERRPAVVPRSSPPRPSPLTAWRTRVESAVSEVRSREEKSSEG*

>peptide 4 (48 aa)
MTRCVLETSSHVSLVVIIQLKCDLLMGCGCMVLLVAPMAIKDRFAGCTG

>peptide 5 (76 aa)
MPCRFPSTPPPPIITETPPPPCTRGRCCVWCLQPLASGARSHVRQRRQPLRLRGVEPHDGHPSLFVNRRRNSVPFA*

>peptide 6 (85 aa)
PSPTSSSIPNRRPWPSTTPPNPPPPVSRVCIQPRGLGPLHVLHHFPHSPHENRRRLTPPPPPRWRPTSPAVCRPHRPRFSLPEHI*

>peptide 7 (50 aa)
SIPNLQLHPQPPPMAVHYTAKSATSCLPSLHSTAWTRSPPRPPPFSPLSP*

>peptide 8 (56 aa)
LHPQPPAPSPTAAHGRPLHRQIRHLLSPEFAFNRVDSVPSTSSTIFPTLPMKIGAG*

Sequence

>CNT30694591
CTCCATCCCCAACCTCCAGCTCCATCCCCAACCGCCGCCCATGGCCGTCCACTACACCGCCAAATCCGCCACCTCCTGTCTCCCGAGTTTGCATTCAACC
GCGTGGACTCGGTCCCCTCCACGTCCTCCACCATTTTCCCCACTCTCCCCATGAAAATCGGCGCCGGTTAACCCCTCCACCACCCCCACGTTGGCGCCCT
ACGTCGCCGGCCGTTTGCCGCCCTCATCGGCCACGATTCTCCCTCCCCGAGCATATATAAACCATTCCCACACCTCCCTCTCCATTTTCCCCTCTCTCCG
GAGCCCTCCCGTGCCCAAAAACCACAGCGCCACCGCCGCTCCTCGCCTCCGCCGCTCGCTGGCGATTTCCAGCCGCCCCTCACCGCTGCTCCAGCCGTCG
CCGCGCCGAGCCGCCGCCACCGCCAGCTTCGCCACCGCAAGGGCAAGCCCGGCCGCCTCTTATTTCCCCCTCTCCACCCCCTGAGCACCACTCCCGCCGC
CAACCCGAGCCACCGCCGCTTCTACCGCCTCCAGTTGCCCGCCACCGCCGCACGCCACCGTTGGTCCCACTGGCTTCGCCATGCCTTGCCGCTTCCCGTC
CACCCCTCCTCCTCCAATCATCACCGAAACTCCACCTCCGCCGTGCACTCGAGGCCGATGCTGTGTTTGGTGCCTCCAGCCGCTTGCCTCCGGTGCTCGG
AGCCACGTCCGGCAGCGCCGACAACCCCTCCGTCTTCGCGGTGTCGAGCCGCACGACGGCCACCCCTCCCTCTTCGTTAATCGCCGTCGGAACTCCGTCC
CCTTCGCTTGAGGTCGCGGCCGCCCTCGTCCGCCGCGTCCCGCCCATGGAGCCGCCACGGGAGCGCCGTCCCGCCGTCGTCCCGAGGAGCTCGCCGCCGC
GCCCGTCGCCCCTCACCGCCTGGCGCACGCGTGTAGAATCCGCTGTTTCGGAAGTTCGCAGTCGCGAGGAAAAGAGTTCAGAAGGTTGAAGTGAAGAAGC
AAGGCAAGTCACACATTCCCCCTTGAGCATGTTGATCCCAATTTGTAAATGTTTTACCGTTTACAAATAAATATGCATGTTTTGCTAATTACATGGGATC
CGGGTATTACCTATCTGCTTGCTTGTACCATGTTTACTTGATATCCGTTCTTTGTTAAACTTTTGTGATAATTCGACTAGCTCGTGTTACTTATGTGACC
TACTAGAATTATATGCTTAGCCATGCTTAATTACCACTAGCTCAGTTGATGGGATAATTATAGTTTTAGACCTCTTAGCATCATGACGAGGTGCGTACTC
GAGACATCCAGCCATGTTTCGTTGGTCGTAATTATCCAACTAAAATGCGACTTATTGATGGGCTGTGGGTGCATGGTTTTGCTGGTCGCACCCATGGCAA
TTAAGGACCGGTTCGCGGGATGCACTGGAA