Detailed information on CNT30694589


BLAST search results

BLAST vs Swiss-Prot:
sp|Q02921|NO93_SOYBN, E-value = 4e-13

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521680Oryza sativaSetaria italica68.639.0190.14142forward
CNT30184907Oryza sativaSecale cereale79.716083.64165forward
CNT30305415Oryza sativaTriticum aestivum48.3118.9486100forward
CNT30226865Oryza sativaHordeum vulgare77.2956.5486.25160forward
CNT30554233Oryza sativaOryza glaberrima99.0331.1698.05205forward
CNT30443535Oryza sativaAegilops tauschii79.7144.9684.85165forward
CNT30255477Oryza sativaAvena sativa80.1938.0784.34166forward
CNT30662828Oryza sativaTriticum dicoccoides79.7120.184.24165forward
CNT30474339Oryza sativaSaccharum spontaneum95.1774.987.31197forward
CNT30141113Oryza sativaLolium perenne80.1942.4682.53166forward
CNT30688349Oryza sativaTriticum urartu78.7481.0984.05163forward
CNT30368308Oryza sativaSorghum bicolor49.7644.487.38103forward
CNT30370478Oryza sativaOryza glumipatula84.0632.3497.7174forward
CNT30107406Oryza sativaOryza longistaminata99.0337.6897.56205forward
CNT30102046Oryza sativaOryza rufipogon99.0331.7398.05205forward
CNT30576821Oryza sativaOryza barthii92.2734.0597.38191forward

Expression of CNT30694589

Peptides detected in this lncRNA

>peptide 1 (68 aa)
DQGLKKAGWGRPVPWKEVFLRCSGAFSKECLLASERIFLSAATKYAIPAAVQMISACPVGLMLAFAHGS

>peptide 2 (67 aa)
SGPEEGRVGAAGALEGGVLEVFRCVLEGVPPRQREDLLVGGDEVCHPGRRADDQRLSRRVDVGLRPRQ

Sequence

>CNT30694589
GATCAGGGCCTGAAGAAGGCAGGGTGGGGGCGGCCGGTGCCCTGGAAGGAGGTGTTCTTGAGGTGTTCAGGTGCGTTCTCGAAGGAGTGCCTCCTCGCCA
GCGAGAGGATCTTCTTGTCGGCGGCGACGAAGTATGCCATCCCGGCCGCCGTGCAGATGATCAGCGCCTGTCCCGTCGGGTTGATGTTGGCCTTCGCCCA
CGGCAGC