Detailed information on CNT30694551


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000913, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30107473Oryza sativaOryza longistaminata10061.0295.1612forward
CNT30102294Oryza sativaOryza rufipogon74.1881.36100454forward

Expression of CNT30694551

Peptides detected in this lncRNA

>peptide 1 (29 aa)
PRTIGGEMHQYLSLLASSSHPFLFLSVFN*

>peptide 2 (29 aa)
MLICFFFMEKCKCSCPSIFCTLNIRESFI*

>peptide 3 (43 aa)
MKMTVTVDMHSYVDVSVSMAIRKCAVSYGLHIVLIWPVIGCDF*

>peptide 4 (52 aa)
MLGEEKKSHLLQLPLDNGIPLNFLYNLSATVQEGLVDVAASHCWLVAHGHPR*

Sequence

>CNT30694551
CCCTAGGACTATAGGAGGGGAGATGCACCAATACTTATCTTTATTGGCTTCTTCTTCTCATCCTTTCCTTTTTCTTTCTGTCTTTAATTGAGACGGCCCC
ACCTTCTAGTCAGTCAACGATTCAATGAACAGTGCATTGACTGGTGTCTTTCAATGTTAGGAGAAGAGAAGAAAAGTCATTTACTTCAATTGCCTCTTGA
CAACGGTATACCACTCAACTTCCTGTACAATTTGTCGGCTACAGTTCAAGAAGGATTGGTAGACGTTGCCGCTTCTCATTGTTGGCTTGTTGCACATGGG
CATCCTCGGTAAATTTCAAACCTTGAAAATTCAGCACAACAGTAACAGTTGATGGCCATTCATGAAAATGACAGTAACAGTTGATATGCACTCATATGTG
GATGTGTCAGTGTCAATGGCCATAAGGAAATGCGCAGTGAGTTATGGACTTCACATAGTATTAATCTGGCCAGTCATCGGATGTGATTTCTGAAATAGTA
ATGTTAATATGTTTTTTTTTCATGGAGAAGTGCAAATGTTCTTGTCCAAGCATTTTCTGCACCTTGAATATTAGAGAATCTTTCATCTAGTCCCGTTATT
TGCTTATTTACG