Detailed information on CNT30694549


BLAST search results

BLAST vs Swiss-Prot:
sp|P14947|MPAL2_LOLPR, E-value = 2e-17

BLAST vs NONCODE:
NONORUT005905, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3067584Oryza sativaLeersia perrieri25.6131.8181.6250forward
CNT30370518Oryza sativaOryza glumipatula52.5668.0489.67513forward
CNT30107148Oryza sativaOryza longistaminata33.465.3397.55326forward
CNT30576665Oryza sativaOryza barthii55.33100.1998.15540forward
CNT30116939Oryza sativaOryza nivara63.22100.1696.43617forward

Expression of CNT30694549

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MFWKDTCMPYFTTGLLPQNNHKKLIVCLLTRSVIFFKTKLFRG*

>peptide 2 (66 aa)
MATLVTSSRLFPLEPSPTLKVTSVAHEPTTNNAATATASRKEDNEAIGELASLLVLSFLFLEGVEGW

Sequence

>CNT30694549
TACGAAAGAAGATAAACGAGCTTCATTGATATGGAAATACATATACATATGTACTCAAACTTTAGAAAAATAAAATGTAAGAAACTATCTAGATGAAGGT
TCACCAACTATACTTTTTCCCACAAATATTATATACGTAATATACTCAAAATCGTCTGGATATATACCTCTGCAGCAACATGCAGACATGGCATACGGAA
TGCTTTATTTTGTTGATGACATATTTCACAAAATAACCATAGAAAATTAATTATTGGCTTCCCCAAATGCAGACTTGATCTCTCTTTTGAAAAAAAAGGA
ATCATAGAGAGGTTAAGAATTATTTCAAAAAAACACACACACAACCATATATTCGAAATCGTGTTCACATATAGCTCCACAACAATGTTTTGGAAGGACA
CATGTATGCCTTATTTTACCACTGGCTTATTACCACAAAATAACCACAAGAAATTAATTGTTTGCTTGCTCACGCGTAGCGTGATCTTTTTCAAGACAAA
ATTATTTAGAGGTTAATAATTATCATGCAACTCAATGCAAGAGTACGCATGTCTATTAATTAGACGTTGATACCACTCTTGTATTCAGAGCCGGCCGTAA
AGCTTTCGGGGATGACGTCGTCGACGACACGGTAGCCGCCGTTCTTGACAAGGAAGCGGACGGAAAAGGGGCCCTTGAGCGCCGCCTCACTCTTGAGCGA
CCAGGTGTTAGTCGACGACTCCTTGAGCGCCACCCAGTCCTTGCCGCCCTTCTCCTTGATCTCCACCTCAGAGATGGCGACGTTGGTGACGAGCTCTAGA
CTTTTTCCGCTAGAGCCCTCACCGACCTTGAAGGTGACCTCAGTGGCGCATGAGCCGACGACCAACAATGCCGCCACTGCCACGGCGAGCCGGAAGGAGG
ACAACGAGGCCATTGGTGAGCTAGCTAGTTTGTTGGTGTTGTCTTTCTTGTTTCTTGAAGGGGTAGAGGGATGGAT