Detailed information on CNT30694484


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554101Oryza sativaOryza glaberrima97.4182.3499.24527forward
CNT30140884Oryza sativaLolium perenne17.9327.1790.7297forward
CNT30368472Oryza sativaSorghum bicolor17.9322.7291.7597forward
CNT30370564Oryza sativaOryza glumipatula89.4610097.93484forward
CNT30102264Oryza sativaOryza rufipogon10079.09100541forward
CNT30576633Oryza sativaOryza barthii88.1795.2199.16477forward
CNT30117076Oryza sativaOryza nivara95.75102.5796.14518forward

Expression of CNT30694484

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MSHLKIHLSNYLFVLLSTHETLAYLYTSLKLTIVLYLPMRH*

>peptide 2 (52 aa)
QTDIITMLADDNGKSNLGTSGSLTVETRHWLHHNTHQWRQQGALSVIGREKK*

>peptide 3 (48 aa)
MMMMDRLTRHRLHPAIPKTIFNFISFRFENVTLENTSFKLPICSSVYP*

Sequence

>CNT30694484
CGCAAACTGATATTATCACAATGTTAGCCGATGACAATGGAAAGAGTAATCTAGGTACAAGCGGATCATTGACGGTGGAGACAAGACATTGGCTGCACCA
CAACACCCACCAGTGGCGCCAACAAGGAGCGCTATCCGTTATAGGACGAGAGAAAAAGTAAAACATCACGATGTGAAGTGAAACTGAATAATTCTAGTAG
ACGATGATGATGATGGATAGGCTCACTCGTCATCGTCTTCATCCTGCAATCCCCAAAACCATTTTTAATTTCATCAGTTTCCGTTTTGAGAATGTCACAC
TTGAAAATACATCTTTCAAACTACCTATTTGTTCTTCTGTCTACCCATGAGACATTAGCCTATTTGTATACATCTCTCAAACTAACTATTGTTCTATATC
TACCCATGAGGCATTAGCCTAATCAAAGTGTGAATCGTACTCCTAATCGTACAAGCCTCAGGCATAGTCAGCTAAGCTTCACACAACGAACTAATGCGAT
ACTATTTTCTGAATTGATCACAAGGATTATGTATGTAGTAC