Detailed information on CNT30694482


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673684Oryza sativaSetaria viridis32.9740.8291.67180forward
CNT30307627Oryza sativaTriticum aestivum15.0222.9785.3782forward
CNT30242892Oryza sativaAvena sativa24.1832.3587.88132forward
CNT30217668Oryza sativaKalanchoe fedtschenkoi15.223.3186.7583forward
CNT30102047Oryza sativaOryza rufipogon40.2944.35100220forward
CNT30576812Oryza sativaOryza barthii32.7839.7898.32179forward
CNT30604205Oryza sativaOryza punctata34.9815.5397.91191forward

Expression of CNT30694482

Peptides detected in this lncRNA

>peptide 1 (34 aa)
ASFYSVMLCSTNTYSALFKLYIFVPCPRPKLHSN*

>peptide 2 (37 aa)
HLFTLLCSVQQIHILLCSSYTYSFRVPDQSCILIEVL*

>peptide 3 (40 aa)
MPISKSGFKHIKVHTDEIAASLQLRHVFSADVQRAQWNHV*

>peptide 4 (52 aa)
MNYTTQLSDKQLCLTVDEQAHELFPVHRLLLHQKLSKLVEDVDVCRDDLRCS*

>peptide 5 (32 aa)
IFLLCYALFNKYIFCSVQAIHIRSVSQTKAAF*

Sequence

>CNT30694482
GCATCTTTTTACTCTGTTATGCTCTGTTCAACAAATACATATTCTGCTCTGTTCAAGCTATACATATTCGTTCCGTGTCCCAGACCAAAGCTGCATTCTA
ATTGAAGTGTTATGATATGAGATAACAGAAGGAATCTGAAGTTTTGATGCCGATCAGTAAATCTGGATTCAAACATATTAAAGTCCACACGGATGAAATA
GCTGCAAGCCTGCAACTGCGACATGTCTTCAGTGCAGATGTACAGCGAGCACAGTGGAATCATGTTTAGTTAGCGGTGCTATAATCGTAAGCACCAACTG
TTTACTTGATCAATGTCAGTATTTGCCATTCTTTACAATGAACTATACAACGCAATTAAGCGACAAACAACTCTGCCTGACCGTCGATGAACAGGCTCAT
GAACTCTTCCCCGTCCACCGTCTCCTTCTCCATCAGAAGCTGAGCAAGCTTGTGGAGGATGTCGATGTGTGTCGTGATGATCTGCGTTGCTCTTGAGTAG
GCCTTCTCCACGAGCTCCCTCACCTCAGCATCCACAACATCCGCGG