Detailed information on CNT30694446


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005905, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102089Oryza sativaOryza rufipogon79.999.6899.36628reverse complement

Expression of CNT30694446

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MFWKDTCMPYFTTGLLPQNNHKKLIVCLLTRSVIFFKTKLFRG*

Sequence

>CNT30694446
TACGAAAGAAGATAAACGAGCTTCATTGATATGGAAATACATATACATATGTACTCAAACTTTAGAAAAATAAAATGTAAGAAACTATCTAGATGAAGGT
TCACCAACTATACTTTTTCCCACAAATATTATATACGTAATATACTCAAAATCGTCTGGATATATACCTCTGCAGCAACATGCAGACATGGCATACGGAA
TGCTTTATTTTGTTGATGACATATTTCACAAAATAACCATAGAAAATTAATTATTGGCTTCCCCAAATGCAGACTTGATCTCTCTTTTGAAAAAAAAGGA
ATCATAGAGAGGTTAAGAATTATTTCAAAAAAACACACACACAACCATATATTCGAAATCGTGTTCACATATAGCTCCACAACAATGTTTTGGAAGGACA
CATGTATGCCTTATTTTACCACTGGCTTATTACCACAAAATAACCACAAGAAATTAATTGTTTGCTTGCTCACGCGTAGCGTGATCTTTTTCAAGACAAA
ATTATTTAGAGGTTAATAATTATCATGCAACCCAATGCAAGAGTACGCATGTCTATTAATTAGACGTTGATACCACTCTTGTATTCAGAGCCGGCCGTAA
AGCTTTCGGGGATGACGTCGTCGACGACACGGTAGCCACCGTTCTTGACAAGGAAGCGGACGGAGAAGGGGCCCTTGAGCGCCGCCTCACTCTTGAGCGA
CCAGGTGTTATTGACGACTCCTTGAGCGCCACCCAGTCCTTGCCGCCCTTCTCCCTGATCTCCACCTCAGAGATGGCGACGTTAGT