Detailed information on CNT30694432


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30694432

Peptides detected in this lncRNA

>peptide 1 (56 aa)
MKKNLSSPKLCLFFSPKSSSSSSSPCQFIVSLNSGELCRHGLVTQSHPSRCSRPPH*

>peptide 2 (44 aa)
MCQLLWLLFGGPTDGYKLETVSLNDASAYLLPKSADLQLGRFLL*

>peptide 3 (47 aa)
MLSASPLVDPVATTPTGHRRWQRDRVLYGMLLPHHPHRFGSLGHSKV*

>peptide 4 (35 aa)
MLNVSLKVHVFVDFSKNEEERSLTPRKRWILASSM*

>peptide 5 (35 aa)
MMRVLIFCPSQLIYSWGGFFFEQQGVMKSIAMRKC*

Sequence

>CNT30694432
CGAAATGAGAAATGAAAAAGAATCTCTCCTCCCCCAAGTTATGTCTCTTCTTCTCGCCTAAGTCTTCTTCTTCTTCTTCTTCCCCATGCCAGTTCATCGT
GTCCCTCAACTCCGGTGAGCTTTGCCGCCACGGATTGGTGACACAGAGCCATCCCAGTAGATGCTCTCGGCCTCCCCACTAGTGGATCCGGTTGCCACCA
CTCCGACCGGCCATCGGCGCTGGCAACGCGACCGCGTCCTCTACGGCATGCTCTTGCCCCATCATCCACATCGATTTGGGTCTTTGGGCCACTCCAAGGT
CTAGCCTTCAAGGGCATGTCCGCCTCCACCATGTCATCGTAGGGCACCGGTCCGCTGCCTTGGTCAGATACGATCGATCCAATCCGCACTGGTGCTCACT
CTGCAGCGTGATCTTGAACCTGTGGTGAATCCATGGAATGATCCCCTAATTCGAATCACACACAGAAAAGCAATGGCATCAGCTCATGTGCCAACTACTG
TGGCTTCTATTTGGAGGTCCAACAGATGGATATAAACTTGAGACTGTTTCTCTGAATGATGCGAGTGCTTATCTTCTGCCCAAGTCAGCTGATCTACAGT
TGGGGAGGTTTCTTCTTTGAGCAACAAGGTGTCATGAAGAGCATAGCTATGCGGAAATGTTGAATGTTTCTCTGAAAGTCCATGTTTTTGTGGACTTCTC
TAAAAATGAGGAAGAGCGCTCCTTGACTCCCCGAAAGAGATGGATCCTAGCATCCTCGATGTAAATTATTTCCCCACGTAGTGTTAGATTACCATATCGA
TGTTTACATACCGGACATTTGTATTTATTATGTGCCATTAACTATATATTCCGCGCACGCAGCGGAGTGGCTGTTTCTTTCTAGTACTTATTATATGACA
CCATATTGCTCTTTCCAAAAAAATATAGCGATTACTTCCAAATAAAAAAAATAATTGTATTTAGTC