Detailed information on CNT30694368


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005072, E-value = 6e-61

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555838Oryza sativaOryza glaberrima23.4628.3997.821560reverse complement
CNT30596425Oryza sativaOryza meridionalis9.5953.395.3638reverse complement
CNT30107155Oryza sativaOryza longistaminata3.0253.7490.55201forward
CNT30102014Oryza sativaOryza rufipogon8.9938.3399.67598forward
CNT30575911Oryza sativaOryza barthii3.2635.486.64217forward
CNT30604471Oryza sativaOryza punctata1.6226.2191.67108reverse complement

Expression of CNT30694368

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MIKQVQTRERAAAANSFSFLLEIRLFVNPAF*

>peptide 2 (29 aa)
MASLHNMETWKLLYKFQVFFSIFNFYKIKN

>peptide 3 (33 aa)
MLYVSKFKYFLIKISVSNIMSRNQLYVVNSGSV*

>peptide 4 (32 aa)
MKIFIWPPYTTWKHGNFYISFKFFLVYLTFIK*

>peptide 5 (39 aa)
MNVFDAHMRLGCTHSCGCKVFVCGYLCFSNFCTQKRYEY*

>peptide 6 (35 aa)
MLNYINAPYIVFLFLISHHVESIPDYVNLFFFFGN*

>peptide 7 (40 aa)
MLRVCLQPLFPNPSPSFSARTLFKLLNGALFVKSFYTKVA*

>peptide 8 (39 aa)
MLLSIYQAGDLKKHRTTVKIERATEIVLLKMSLVPEIVH*

>peptide 9 (29 aa)
MINLVISFSYAQIGTILVKILRRHCLVST*

>peptide 10 (80 aa)
MSVSCGHWGISLGCGCCVWLYTSDGERAGNAQHILICYCWSHACILVPNLKYMRHVANWPSYYSSSPPFSNPVIPTYRKY*

>peptide 11 (46 aa)
MNAKGVFATPFSQPISLVFRAHAFQTAKRCVVCKKFLYESCLKKSN*

>peptide 12 (46 aa)
VDYVDVVGWKRPYFSFRQTADAKHFRNRCHVLVLLNNLVNARIQMG*

>peptide 13 (57 aa)
MHYFFYIYIYTIIKIKDVFASTLVRHLCMSRFSSLFTFRNTYPYLSRLLSLFAFGNT*

>peptide 14 (42 aa)
MFSLHHHLSSSYPLSLSLSYTTYSFFFIESPEATASWPASSV*

>peptide 15 (62 aa)
MRETSLEHRSSISPRSFIVDVSSSFMSNVLPPSPPLLFIPSLSLSLIHNILFLLYREPRGHS*

>peptide 16 (42 aa)
MHMLYADACIYCYPRCNRIVTYEFVISEVLIWNSMVECFIQC*

Sequence

>CNT30694368
TGTTGACTACGTGGACGTGGTAGGATGGAAGCGCCCATATTTTTCATTCCGTCAGACGGCAGATGCAAAGCACTTTCGAAATCGATGCCATGTCCTAGTT
CTACTTAATAACTTGGTCAACGCTCGTATCCAAATGGGATAGGTAGAGAGAAGCAAGTAATATAAAAAATAATTGTCTAGAGAAGTATGTAGACAACTTA
GTAGTAACTATTATACTTAACATCTCTTGGTTGTCTCTCAATGACATTTATATTTCTATAGCCATTAATTGACTATATTATTGAACTTGCTCTTAGTATA
TATTGATTCTCGAATATTTGACTGTATATTGTGTAGCAATTGTTTTTGCTATTATCTATATGTTGTTAAATTCTTTATTGCATTTAAGTTGTTATGAAAA
GACGTTATGGAAGGAACGGAACATATTTATATCCTTATAGTTCCGAGATACTTTGCTACTAAAAGTTAGAGCAAATATACGTGATAATTGTGAACTGAGC
ATGGCTTAATAAGTTAGGGTGTTGTTATGAAAACTATCCACTCCAAACTCAAAGCGGTGCTTATATTTTTCTCAAGATAAATGTTAAGAAATAATAAATG
TATGGTAAAATATAAACCGATAGCACTCTCAGGTTAGTCTTAACCAGAGAAACATATAGGTTAGAGTACTGTAAGTTGCTACTAGTACACACTACACCAT
GACCTGATATTCATGGCACTTAACTGCCGGCAATAAAATGAAGTTAGTGGCGAACTATTTGCCGGAAATATATCAAGTGCCGGAAATAATCTTGGACATT
ATCTCATTTGCCGAGAATTAAAAAAATAGAGCAGCAAATTAAGTGCCGGCAATGAATTAATATAACATGTCAATTGATCTGCCATAGATAATTTAAGACA
ACACATAATCTGCCGGGAATTTTGTTACCGGGAAAACAAATTTCTAGTTAACTTTTTGAGGAAATTTTGGCGGGCTAAAAATATTATTGGGCCGAGCAAG
GCGCCAAGGTGCGAAAACTTTCATGGGCCAAACCTGATTCCACTCCCATCTGCGTACCCTATTCCTCATCTGTGCCGCACTCCTACTCCACACTCGATTC
CTCATCTGCGCTGCTGACACTAGATTATCAACAAACATCTATCGGTAAAGATTAACAATTATTGATAGACTATTTGTTGGTAAAGGCTTTTGGCAAATTA
TGTGTTGGCAATGCTATGTAATAAGACATGTTATATGTCAGCAAATTTAAATATTTTTTGATCAAAATATCTGTCAGCAATATTATGAGCAGAAACCAAT
TATATGTCGTGAATTCTGGGAGTGTTTGAGAGGAGAGGAAAAGAGACGATTGAGAAGATACGCAAAATGAGGTGAGCCATTAGCGCATGATTAATTAAGT
ATTAACTATTTTGAATTTCAAAAATGGATTAATATGATTTTTTAAAACAATTTTCCTATAGAAATTTTTTACGAAAAATACACCGTTTAATAGTTTGAAA
AGCGTACGCGCGGAAAACGAGTTTCAATCTCCCCTATCTCCATTGAACTCCGTCAGATCTTGATCCCATGGTTAAGATAGAGTGAGGTGTAGCCTCGGGC
GGCAAATTAATTTAGGGGCGCAAGAAAATAATAAAAAAAAGAATCGCCCAAATTTTTTCCACGCCAAAAAAAAAAATCCACGCCAAAAAGAAAATCGACG
CCAAAAAAACCCTAGGCGCCGCCACCTCGTGCCCCCTTCCACCGCGCGCGCCTTTGTCGCCATCCACCGCCCGCGCCGCCGCCTCCTCCGCCAAATCCAC
CGCGTGCGCCCCCCGCCACCGCGCACCACCTCCTCCGCCAAATCCAGCGCCCCCCGCCTGCTCGCTCCTCTCCCACCACGCGCCGCCTCCACCACGCAGC
CCCCTCCGCCTCACCCACACCGCCGCACGCCGCCGTCGACTCCATCGGCCAGCCGCCGCTACTCCCTAACTCCGACTCCACTCAAACCCTCCCCTCCTCC
CCACCTCTGACTCGACCTGCACGCTGGCTTCCGCTATCGGCTCCTCCGCCCAACGCCTTCCCATTGCCGCAGTTGACTCCACCCTCTTCCCCACCTCCTC
CGCCGCCTCCCCATCGCCTCCACCTCTGGTGCCTGCCTCCACCTCATCTTCCGACATCAAGGAAGTCCCCTTGTTCAGTTTAGTTTGCCACTATCGATTT
TGCTACAATCGATCTATGTTGTTGAGCATCTACCAAGCAGGAGATCTAAAAAAACATCGTACCACGGTCAAAATCGAAAGGGCTACTGAAATTGTTCTGC
TAAAGATGTCACTTGTCCCAGAAATTGTCCATTGAAGATTTTTTTTGCTGAAGTTATTTATGAATGGAGACCTGCTAAAGATGTCACGTGTCCAATAAAG
ACCTGCTTAAGATGTCACTTGTCCAATGAAGTTCTCTCTGTATTTATATTATCTAGAAGAGATGCCACTTCAATGTAGAGTAATTCCATAAACTTTGTTG
AGAAGTTATGACTTAAATTTAATGAATGCTAAGGGTGTGTTTGCAACCCCTTTTTCCCAACCCATCTCCCTCGTTTTCCGCGCGCACGCTTTTCAAACTG
CTAAACGGTGCGTTGTTTGTAAAAAGTTTCTATACGAAAGTTGCTTAAAAAAATCAAATTAATCCATTTTTGAAAAAAAATTAGCAAATACTTAATTAAT
CACGTGCTAATGGATCGCCCCGTTTTCCGTGTTTACTGTGCACGCTGGGAACCCAGAGTAGCGAACACACCCTAAGAGTTGTCTGTACTCTTGTATGCAT
ATGCTCTATGCAGATGCATGTATATATTGCTATCCTAGATGCAACAGAATTGTTACTTATGAATTTGTTATTTCTGAAGTTCTGATTTGGAATTCTATGG
TGGAATGTTTTATACAGTGTTGATGGATGTATGTTTAATCTGAACTATTGAATGCATGGTGAATTAATGTCTGCAATCTGAATTTTTATCTATTTTACAA
ATCGTACAATTGATTTGGTGCATGCATGCCTTGTGAAAAAATCATGCCAGCAAACACATATAACTGCCAGGGATAGTTGACTGATGTGCTGAGGATGTTT
CAAACATTTAGGGCATTTAATTGCCGGTAATCTGAACATCTGCCAAGGAAACCGAATTGCAACTACGGCAGTTAACTGCCGGGAACTTGTTATCTGCTGG
CTAAGAGCATTCCCTATAGGACTTTGTAGGGCAGTTAGTGCCAAGAAAGCCTTTTACCGGCAGATGAATTGCCATACAAACTATTTTTAAGGGCAGCTGT
ATTGCTATAAACACTAGGCCATGGTGTAGTGACACCCAAAAGTTTCTTCTTATAGAATTTTCTCTTAAAATATTTATCAGATCCACAATCTGATTACACC
ATTGCGTTCATTGTAATTAAACCTTTATAACAAGATCTTACATGATTATATTATGATAAAAAATATTTATGTTTGTAAATAACTTTTATTATATATGTAA
GTTACTTTTATCATATATATAAATTACTTTTATATTTGATTAAATTACTTCTTATACATTCATAATGCTTTGAGTTGATCACTTTTATTATTGTTTTTAG
TCAATTCCATAATTGGTGATGATTAAATTTAATTTCTAGATAGACTCATATTATTATCCCTACAACGGGTTTACATTAAAAATATTGTAACAACCTACTT
CCATTTTGTATAAAGTTACTTTTATGATTTTTGTAAATTACTTTCAGACTTTATTGAATTTACTCTCATAAATGTATTTACTTGCAAATCTTCTCTACAC
TTTGCTTGTGAATTTATTTCATATAGTTTCTTATTTCAACTCAGTCATAATATAATTACTCCTAATGTTATACTCCCTCCATTCCAGAATATAATCATTT
TTAGAGTTGGACACGGTTATTAAAAAAGTAGGTAGAAGTGAATGGTGGAGAGTTGTGATTGGTTGAGTAGTGGAGGTAGGTGAGAAAAGTGAATCGTGGA
GGATTGTGATTGGTTGGGAAAAGAATGTTGGTGGAGAAGGTATTGTATTTTGGGACAAATCTTAAGGGGTAAAAGTTGTTATATTTTAGGACGGAGGGTG
TAGATAGTTACTTCTACAATTTAAATAAATTACCTTTAAAAGTAATGAAATGTTTGAATATATTCAATATGGATCTCGTTTTGTCTTATATTTTGAGTAG
AGTACAATGATGCAAATAGATCTTAAAAAAATATGTGATTTAAAAGATACACGTCATTAAAGAGGTTAAAAAAGACAAACACCATATGCTAAATGAGGAT
TTATATATGGGATGAAGTGGTCTCCGGTTAGGACTAACGCACTACCGTACACTACCTAGATGTATATATGAATGTGTTTGATGCTCATATGAGGTTAGGA
TGCACCCATTCTTGTGGATGTAAGGTGTTCGTGTGTGGGTACTTGTGTTTCTCTAACTTCTGTACTCAAAAGAGGTATGAGTATTAATTATTTGATACGT
GTAGTTAATGAAGGATGGTATAAGAGCAGGTACAATAGCAGGCTATAAGCTAGCTATAAACATATTTTAAAAAGATAAAAGAAGAGAGAGAAAAGCAGCA
GGCTATAGATCTTAGCCAGCTACAGCACGGAATCTAAGACGTAATGTGTGTATGACTGGTAAGACCAGGTATTAATAGTGTAGTAAGCAACTATTATATG
AATTGACTATTATATTAGCTATAGATTATTTGGAGCTAGTAGTTGGCTATACTATTAAACTTGCTCTAATATTTTATTTTCTATAGTCAACATAACATAA
CTTTCACCATCGAATTTTCTTGCACAAATCTGGACAAGTTAGGTACTATGAAAGAATTTCCATGATAAATTTGGTTATATCATTTTCATATGCCCAGATA
GGAACCATACTAGTCAAAATTCTAAGAAGACATTGTTTGGTGAGTACATAATTAGCACCACATACCTTCCTAATAAAAAATGTTTCCCCACTTCTCCAAC
TTGTATGACGTGAAAAACGCATGTTAAACTACATAAATGCTCCATATATAGTTTTTCTTTTTTTAATATCTCACCATGTAGAATCCATACCCGATTATGT
TAATCTTTTTTTCTTTTTTGGTAACTGATTCTGTTGATCTCAACCTTATAATAAAAACGTTCATAGATTGCATGTAGTAAAAATTTGTTTTGTGTATGTA
AAATCTCTTTAATGATCAAACAAGTGCAAACGAGAGAGAGAGCAGCAGCAGCTAATTCTTTTTCATTTCTTTTGGAAATCAGATTATTCGTTAACCCGGC
TTTCTAACCCGACTTGTATCACCAATGCACTATTTCTTCTATATCTACATCTATACTATTATAAAAATTAAAGATGTTTTTGCCAGTACTTTGGTACGTC
ATCTGTGTATGAGTCGGTTTTCAAGTTTGTTCACTTTTAGAAATACATATCCGTATTTGAGTCGTTTATTAAGTTTGTTTGCTTTTGGAAATACATAAGA
GTTGATCTATAAAAAATCTCTTAAAAAAACTCGCATGCTAACTTGAGACGATCGGACTCTAATTACAACTCATGATTTTAAGCGAATTCCCACAATGAAG
TTCACTTAATTAAACTGTATAACAATAATAAAATAAAAATAACCTTCATCCGTCGCAATGCACGGGCATTTTTTCTAGTCTAATCATATATATATATAAG
CCAGCAGGATATAAATTTGTAAAAAGTTTTGCTAATTTACAGTACCTGCTGTGAGGTGGTTTCCAGCAGCAAGTAGTCTTGTGGAATGAGAGAGACAAGC
CTTGAGCACAGATCTTCCATCTCGCCCCGCTCCTTCATCGTCGACGTCTCTTCATCCTTCATGTCTAATGTTCTCCCTCCATCACCACCTCTCCTCTTCA
TACCCTCTCTCTCTCTCTCTCTCATACACAACATACTCTTTCTTCTTTATAGAGAGCCCAGAGGCCACAGCTAGCTGGCCGGCCAGTAGTGTCTAGCTTA
TTATGAATGGGTTAAGATGAGTGTGAGCTGTGGTCACTGGGGTATTTCGTTGGGATGTGGATGTTGTGTGTGGCTCTATACAAGTGATGGTGAGAGGGCA
GGAAACGCACAACATATCCTCATCTGTTACTGTTGGTCCCATGCATGTATCCTTGTTCCCAACCTAAAATACATGCGTCATGTTGCCAATTGGCCATCGT
ACTATTCGTCCTCTCCCCCTTTTAGCAATCCAGTGATTCCTACTTATAGAAAATATTGATCGTTGCCTGGAAGCTGGTGTTGACTCGTTATCCTTATGGC
CTTGTTTGGTTTAGCGGGGACTAAGGAGAAATGAGGGATGATAAAATCTACTCAATGCCACTGAGTTTGTCAATGTTCAACGGTTTACCACTGACATTGT
CTCTTTCTCTAATATAGCGGTGACTTTATATATTGTTCGACGATATGCCATTGGATTGGACTTTTTTCAAAAAAAAATGCCCAAAATACCCTATATACAT
ATAATGTTAACAATTAATTTATCTTATTAGAAGTTTCGAAAAAATATGAAAATTTTTATATGGCCTCCTTACACAACATGGAAACATGGAAACTTCTATA
TAAGTTTCAAGTTTTTTTTAGTATATTTAACTTTTATAAAATAAAAAATTT