Detailed information on CNT30694358


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FX94|CXE5_ARATH, E-value = 2e-19

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101967Oryza sativaOryza rufipogon46.4153.97100401forward
CNT30117093Oryza sativaOryza nivara46.4160.21100401forward

Expression of CNT30694358

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MGSGWWPDRETEMSWPPATNRAGNLKRSLVHFKKFNAGE

>peptide 2 (33 aa)
MSRETTRVTGSVPAGTVGSPPRRKTRPLLYWQR*

>peptide 3 (40 aa)
SNQISINSTGITNYFVANNGRSHHNNMAKEKEKEKFPHLI*

>peptide 4 (38 aa)
MNSTLRSSSSTAWSEPAMPTKWNAWPTPLDSNSSTSPP*

>peptide 5 (40 aa)
MADGERLVAGSGDGNELATCNKSSWKLKKKSSSLQEVQRGG

Sequence

>CNT30694358
TCGAATCAAATTAGTATAAATTCCACAGGTATTACAAATTACTTCGTGGCAAATAATGGTAGAAGCCACCACAACAATATGGCAAAAGAAAAGGAAAAAG
AAAAATTTCCCCATCTTATTTAGATTAGACTAAACACGCTCCAAATCTGACTCCGCCGCCGGCGATCTTCATTTCTTGATGAATTCGACGTTGCGCTCCA
GCAGCTCGACGGCCTGGTCGGAGCCCGCCATGCCGACGAAGTGGAACGCGTGGCCGACGCCCTTGGACTCGAACAGCTCCACCTCGCCGCCATAGCCGCT
CGCCTTGAGCTCCCGGTGGTACCACAGCCCCCGCTCCTTGAGCAGGACGTCCTGCTCGGCCACGCACACCTGCACGCGCTCGCACGGGATCGCGGCGGCG
GGAGAGGTCGGCGTGGTCGAGCAGCCACGGGTCGGCGCCGTCCCCGCGCGTCGCCGCCCACCGCACGGCCGCCCACGCGTCCTCGTACGCCGCCGGGAGC
GGGTTCTCCGGCGCGAGGCGGTAGTACACGGACACCCCAATCGCGCCGGCCCGGGCCACGAGATCGTTGAGGTAGACGCGCGCCCTGGCGGCGCCGGCGT
GGATGTCGCGGGAGACGACGCGGGTGACGGGGTCGGTGCCGGCGGGGACGGTGGGGTCGCCGCCGAGGCGGAAGACGCGGCCGCTCTTGTACTGGCAGAG
GTAGGGCTGGAAGTCGAAGGCGACCTCGGAGTCGGGATCCATGGCGGATGGGGAGCGGTTGGTGGCCGGATCGGGAGACGGAAATGAGTTGGCCACCTGC
AACAAATCGAGCTGGAAACTTAAAAAGAAGTCTAGTTCACTTCAAGAAGTTCAACGCGGGGGAG