Detailed information on CNT30694340


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369237Oryza sativaOryza glumipatula43.9527.3995.64298forward
CNT30109114Oryza sativaOryza longistaminata43.2271.9990.78293forward
CNT30103539Oryza sativaOryza rufipogon33.9284.8780.87230forward

Expression of CNT30694340

Peptides detected in this lncRNA

>peptide 1 (43 aa)
RGWCDERIDQLAAIATGQLRKKSSLSRSLSLLWWSERWMPSGL*

Sequence

>CNT30694340
ACGCGGTTGGTGTGACGAAAGGATCGATCAGCTAGCTGCTATAGCTACCGGGCAACTCCGCAAGAAGAGCTCTCTCTCCCGGTCCCTTTCTCTCCTGTGG
TGGAGCGAGAGATGGATGCCTAGTGGACTCTGAACGTGGAGCTGAAACTGTTTGACTAAGCTTCAGCTTCAAGAGATGTGGAACTGAAACTGTTTGGCTA
AGCTTCAGCTTCAAGAGAACTGGAGCTGGAGCTGGAATTGTACCAACAAACATACCCCAATTAACACACATCTAAATAAGATTGAAGGCCGTCCTATAAC
CTCACGGGCAACGCATTAGCTCCAGTTTTGGGCACAGCTACAAAGGTGTGAGGATGATGGGGAATTCCTAAAGGTTGCATGCCGCAGGTTGGAGTCGATG
GTTATGCAACTATTTGCCAATTATGGGTGGAGGTTCATAAATAGACTTCAATAAATGTGTTCTCCTTATTTTGGCTTGGTTACCTTTGTTTTTGTTTGGT
GTGTTCTTTTTATCTGAACTACACTCTTTTCTGGAGTGCTACTTTGTAATAATTGGCTGTAGCTCTTTTTTAGCAAAGTCTGGGATGTTATATTCCATTA
TCTAAAAAAATTAATCTCTATTATTATAAAAATCGAAGATGTTTTTGTCGGTACTTTAGTACGTCATCCATGTATAAG