Detailed information on CNT30694298


BLAST search results

BLAST vs Swiss-Prot:
sp|Q5Z9Z3|OCLOT_ORYSJ, E-value = 3e-21

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30305983Oryza sativaTriticum aestivum55.453986.32117forward
CNT30102354Oryza sativaOryza rufipogon78.223.88100165forward

Expression of CNT30694298

Peptides detected in this lncRNA

>peptide 1 (69 aa)
LTTASTLSARKRSSFTLPSASSPAAKSLSKWASKSATVASTFSTVMSALRLLAFLGGGGGGGGGGGGRGS

>peptide 2 (69 aa)
VDYGVDLVGEEEEQLHLALGVVPGGEELVEVGVEVGDGRVHLLHRHVRPSSPRFPRRWRWRWRWRRREGE

Sequence

>CNT30694298
GTTGACTACGGCGTCGACCTTGTCGGCGAGGAAGAGGAGCAGCTTCACCTTGCCCTCGGCGTCGTCCCCGGCGGCGAAGAGCTTGTCGAAGTGGGCGTCG
AAGTCGGCGACGGTCGCGTCCACCTTCTCCACCGTCATGTCCGCCCTTCGTCTCCTCGCTTTCCTCGGCGGTGGCGGTGGCGGTGGCGGTGGCGGCGGCG
GGAGGGGGAGC