Detailed information on CNT30694252


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30370387Oryza sativaOryza glumipatula61.858098.36428forward

Expression of CNT30694252

Peptides detected in this lncRNA

>peptide 1 (32 aa)
QSPSTSEHIEQHNPSPPSPQLPTIPKICSQST*

>peptide 2 (45 aa)
MPLGVLKIKGMLFMTMTCIMEDGMSRCMQGSGLVALLVNLEYWST*

>peptide 3 (29 aa)
MYAGEWSSSFVSEPGILEHLVTKVLLAPA*

>peptide 4 (61 aa)
NHLQPVNTSSNTTPLHLHLNCQPFPRFVANQPENGDVEHHHQLGRKEDCRFGEELDLQGEE*

Sequence

>CNT30694252
CAATCACCTTCAACCAGTGAACACATCGAGCAACACAACCCCTCTCCACCTTCACCTCAATTGCCAACCATTCCCAAGATTTGTAGCCAATCAACCTGAA
AATGGTGACGTAGAGCACCACCATCAGCTCGGTAGGAAGGAGGACTGCCGGTTTGGGGAAGAACTGGACCTGCAGGGGGAGGAGTGAAGCTCATTAGCTG
CAAACTTGTGGGGGATCAATCAAGAAAACATCACCCACCAACAGAAAGGGAGCAGAATGCAGGAAGGGAACTAGGGGCGGAGTCGGGTTAGTGGGGAGTG
CCAGCTAGTTTCGATTTGAACTACGAGGATTCAGATGCAAACATTTCTGGGCAAGCCAGTGAGTTAAGTGGTGGGTTGGAGGATCAGTACTATGCCCCTT
GGTGTGCTGAAAATCAAGGGGATGTTGTTTATGACTATGACATGTATTATGGAGGATGGGATGAGTAGATGTATGCAGGGGAGTGGTCTAGTAGCTTTGT
TAGTGAACCTGGAATATTGGAGCACCTAGTGACCAAAGTATTGCTAGCTCCTGCTTGAAACTTGTATTATTAATGGGTGAACGTGTAAGGCCCTGTTTCA
GACTTTAGCCCTGCGTGACATGGTATTGTAATGTTATCTGAACCTTCTAGCTATTATTCTGTTGCTATCTCTGATGTGGATCATTATTCGCT