Detailed information on CNT30694239


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3067640Oryza sativaLeersia perrieri10.1327.8789.7168reverse complement
CNT30109572Oryza sativaOryza longistaminata42.4731.8899.3285reverse complement
CNT30101997Oryza sativaOryza rufipogon75.71100.299.8508forward

Expression of CNT30694239

Peptides detected in this lncRNA

>peptide 1 (70 aa)
RGTTARPPGGSPAAASTARRRRHASSVWSSSPPAPPASWSPRASPSARRGGCAGTSPTATSFAPRSSSSS*

>peptide 2 (31 aa)
MQNKRLIDWLPGLKTNSISYLRILVIIFQPK*

>peptide 3 (96 aa)
QRHDGEATRGLPSSCFDCAAAAACFVGVVIITAGASGELVTESFPVGEAWRMCRNFPDGDFFCTEIFFIVIGLFSCSSIAAGATIFDKKNKLFQDK*

>peptide 4 (86 aa)
AEARRRGHPGAPQQLLRLRGGGGMLRRCGHHHRRRLRRVGHRELPRRRGVEDVQELPRRRLLLHRDLLHRHRPLQLLLHCRRSDDL*

Sequence

>CNT30694239
GCAGAGGCACGACGGCGAGGCCACCCGGGGGCTCCCCAGCAGCTGCTTCGACTGCGCGGCGGCGGCGGCATGCTTCGTCGGTGTGGTCATCATCACCGCC
GGCGCCTCCGGCGAGTTGGTCACCGAGAGCTTCCCCGTCGGCGAGGCGTGGAGGATGTGCAGGAACTTCCCCGACGGCGACTTCTTTTGCACCGAGATCT
TCTTCATCGTCATAGGCCTCTTCAGCTGCTCCTCCATTGCCGCCGGAGCGACGATCTTTGATAAGAAGAACAAACTCTTTCAAGATAAGTAAATTTCCTT
CTGTGAATACAAAAAAAAGTTTGCTTCCAATCCGCATAGAAGAGAGAGAAAGAAGGAATGCAGAACAAGAGATTGATTGATTGGTTACCTGGATTGAAAA
CAAACTCTATAAGTTACCTACGGATCCTTGTAATTATTTTTCAACCTAAATAGAAGATTAGAAGTACTCTATCGGATTTTGTATAGGGAAGTACTAGTCA
CAAATTAAAGTGGTGAAAAGAGAGTGGTTTATCAGAGCCTAACTCTATTTAAGGCTACATAACAGCTGCACATGCTATTTTTATCATGTCCTCCTAATTA
ACTGGTCTTATCCTGTGCATCAGATATATCCAACATGCATGCCCGTTTATCTGTTGAACAAGTGTGAGTGT