Detailed information on CNT30694227


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553992Oryza sativaOryza glaberrima20.6363.1894.93592forward
CNT3067041Oryza sativaLeersia perrieri11.1520.2782.19320reverse complement
CNT30105326Oryza sativaOryza longistaminata76.9750.0597.562209forward
CNT30102172Oryza sativaOryza rufipogon100.2471.8799.032877forward
CNT30576862Oryza sativaOryza barthii33.3143.6799.06956forward
CNT30116895Oryza sativaOryza nivara7755.3299.232210forward

Expression of CNT30694227

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MHPLEISIENSNGWYLQWVNPFCSKSSQENKMMQRVCANSVEYRK*

>peptide 2 (52 aa)
MVENKENVLEWLRLTTVNSKQLQMPLVLATCNYSLHPSVHEQMSRIIHYSMY*

>peptide 3 (53 aa)
RAIRLIYKARQITITSQILHWQIVHCQNHNAGCWEKTTTIKQNKKKSAGKGRR*

>peptide 4 (55 aa)
MPLDWVSATCKCKFSGINESKNVFYESEKISSIQLLASQQTEKYQTWIYTDTIQP*

>peptide 5 (39 aa)
MVGTSNLHESFLFEVCQENKTMRCVCIISVNTNTENKRN*

>peptide 6 (41 aa)
MPNDLQWAAKSSQPFKKLKITTWHFLTFKVVFESPEDEGCV*

>peptide 7 (36 aa)
MAQINLNGNSNSSECPWFRQHVSTPSVHFVHEQNDE*

>peptide 8 (34 aa)
MSCSKICLEHITKEPRRCRMISNGQQNHHSHSRN*

>peptide 9 (30 aa)
MISNGQPNHHSHSRNKKITNNEICIHRSML*

Sequence

>CNT30694227
AGAGCTATCAGATTAATATACAAGGCACGTCAGATCACTATTACATCACAAATATTGCATTGGCAAATAGTTCACTGCCAAAACCATAATGCCGGTTGTT
GGGAGAAGACAACAACAATAAAACAAAACAAGAAAAAAAGTGCTGGTAAAGGCCGAAGATAAATAATACATAAAAGGAAGGCTTATTTTGTTCTTTGGAA
CTATGTATATACAAGATGGTGGCCTTGTTTGTAACCTGTCTAAGTAGGGAAATCAGCACAGACATGTGACAATGCTCAAAGCATTTTATCCCGTGATAAT
TATTATGAGGATTTAGATGGTTGGTACCTCCAATTTGCATGAATCCTTTCTGTTCGAAGTCTGCCAGGAAAACAAAACAATGCGATGTGTATGTATAATA
AGCGTCAATACAAATACAGAGAATAAAAGAAACTAAAACTTGCAAACTATCAAAATAAGAGGGGAGATTTTTGCCTTTCGCCACGGACTTGTTACATCAT
CTCATACATGCCACTTGATTGGGTCAGCGCAACATGTAAGTGCAAATTCAGTGGCATAAATGAAAGTAAAAATGTGTTTTATGAATCCGAAAAAATCAGT
TCTATACAATTATTAGCTTCTCAGCAAACAGAAAAATACCAGACATGGATCTATACAGATACAATACAACCATAAGAAACTAAGGACTGTTTTGGGCAAA
ACATGGTTGAAAACAAAGAAAATGTACTAGAATGGCTCAGATTAACAACTGTCAATTCCAAACAGTTACAAATGCCCTTGGTTCTGGCAACATGTAACTA
CTCCCTCCATCCCAGTGTACATGAACAAATGAGTAGAATCATTCATTATAGCATGTACTGACAAGAAATAGCTGCAACTGGTAACTTGCTGGGGAGCAAG
GCCTCCTAGCATGACAGCTAATTGAACATATTACCAAGGAACCGAGAAGATGCCAAATGATCTCCAATGGGCAGCCAAATCATCATAGCCATTCAAGAAA
TAAAAAAATAACAAACAATGAAATATGCATCCACAGAAGTATGCTGTGAAAGTATGAAACAACAAAAAGAAAGATCACGCTAAAGCTAACTGAATAAACA
GTTAACATTCCTTTATTAGTGTTACATTACTTAATTTTAGAAAAAAGAAACAATTAAGCTCCTATGAGCAAGTATTGTCATCACCGTGCAGTAAGCAAGT
TAGACTACAAGTATTGCCCTGGTACCATAACATCCCCCCATTTATGATTTATTCATTCTGGGAAGACTTCGTGCTCATTAAAGTGCCTGCTGGTAAAAAA
GTAAGAACTAAAATACCATTGAGCTGATTACCAACAGGATATTGCAATGGGTAAAAAGTAGCAAACTGCCATCGCGAGACATGCTTGCTAATTTGCCAGA
GCACTGTAAAATGTCGGTTGTGGGAGAAGATAACACGAATAAAACAAAAGGAAATAAGTTGCGCTGAAGTGCTGATAAAGACTGAAGATAAATAATACAC
AAAGACGACTATTTTTTGGTCGGTAGGGATATCAGCACAGGCATGTGACAATGCTCAATGCACCCATTGGAAATTAGTATTGAGAATTCAAACGGTTGGT
ACCTCCAATGGGTGAATCCTTTCTGCTCTAAATCTAGCCAGGAAAACAAAATGATGCAACGCGTTTGTGCAAATTCCGTGGAATACAGAAAATAAAATAA
ATTTACAAACTCAAATATCAAAACAAGAGGGGAGATTTTTTGCCTTTCGCCACTGGATAAGATCAAGGCAACGTGCAAGTGCGAATTCAGTGGCATACAT
GAAAGGCAAAATGAGATTTATGAATCCAGACAACTCGGATCCATACAAGTACAACCAGGAAAACTAAAGACTGCTTTTGGGTAAAATAATGATTGAAAAG
AAAAGAAATATATTTGAATGGCTCAGATTAACCTAAATGGCAATTCCAACAGTTCTGAATGCCCGTGGTTCCGGCAACATGTAAGTACTCCCTCCGTCCA
CTTTGTACATGAACAAAATGATGAGTAGAATCATTCGTTATAGCATGTACTGAGAAGAAATAGCTGCAACTGGTAACTTGCTGGGGAGCAAGGCCTCCTA
GTATCACAGCTAATTGACATAGGCATGTCCTGTAGCAAAATTTGCCTTGAACATATTACCAAGGAACCAAGAAGATGCCGAATGATCTCCAATGGGCAGC
AAAATCATCACAGCCATTCAAGAAATTAAAAATAACAACATGGCATTTTCTGACATTTAAGGTGGTGTTTGAATCTCCTGAAGATGAAGGCTGTGTTTAG
TTCACACTGAAGTTTGAAAGTTTGGTTTAAATTGGAACGATGTGACTGAAAAGTTGTGTGTATAAAAGGTTTGATGTGATGGTAAGTTGGAAGTTTGGAA
AAAAAACTTTGGAACTAAACAGGGCCAAAGATAAAGATTAAGTGTTTCACGCAAAACGAGGTGGTAATAAAGTGAAATACTATGCCACTGCTTCAGATAT
CAATGTTGCATTTGCTGACATTTAGTAGGTATATGCAGAATGGAATGACCCTTTCCATGTGAAAATCAATCACCAAGAAAACCAGATAGAACAAAACGGA
AATATTAGGGAAGGACCTAATATCAAATAATTATAAGGGGTGAGGCTTCGAACCCAGGTCGTCTAGCCCACCACCTTGTGGAGTTAGCCGGAAGACCCCT
AGGCGTTTCTCCGGATAGATAGAACTGAACCCCATAAAACCATTCGTCCGTATTACTCCAAATCCCGTTGCAAAGCACGGGCATAGCACTAGTGCATGAA
AAGAAAAAGGAACTGTAGCCAATGCGAAGAATACAAATGCTTGAGGAACACAACTGCATCGAGCACCTTC