Detailed information on CNT30694093


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101998Oryza sativaOryza rufipogon53.6827.8398.88357reverse complement

Expression of CNT30694093

Peptides detected in this lncRNA

>peptide 1 (42 aa)
LATPLAQPRRHCRSGPRPRLASSSSSSAEYSESAAEGAMASE*

>peptide 2 (29 aa)
MVSLICWACNGWVWRKILIYVNCSDLGCD*

>peptide 3 (53 aa)
SPPRSHNPAATAAPAPAHAWHPPPLRPLSIASRRLRERWPQSRAGRVGEVDEF*

Sequence

>CNT30694093
CTCGCCACCCCGCTCGCACAACCCCGCCGCCACTGCCGCTCCGGCCCCCGCCCACGCCTGGCATCCTCCTCCTCTTCGTCCGCTGAGTATAGCGAGTCGG
CGGCTGAGGGAGCGATGGCCTCAGAGTAGAGCTGGTAGGGTGGGGGAAGTGGACGAGTTCTAGGTGGCCGCCACTACTCCACCTCCACTGCTGCTCCGAC
CCCTGCCCACTCCTGGCCACCTCCTCCTCTGTCCATCGCCTCTCCTCCTCCTCATCTGCCTCCTCCTCCTCCTCACCACTTCCTCGTCGCCTTCGAGCTC
TCTCTCCCTAGCCGCGCTTGATCTAGCCGCCTAGAGGTCAGGGACCGTCGGATCTGACCTCCTTGAGGTCGGAGCACGCTGGATCCAGCCGCAGCCGACC
TTACTATCATGGATCACCTCACACGCACTCGGGGGCTGGTGTGGTCTGGCTGGAAGGAGATGATGGCAGCGACGGCTCGAAGGAGATAAGCAGCAAGGGA
ATCGATGACGACGGTAGCAGATCCACATCCACTGGGATGGTGAGTCTGATATGTTGGGCATGTAATGGTTGGGTATGGCGGAAGATTTTGATCTATGTGA
ATTGTTCTGATCTGGGATGTGATTAGCTTGTTCTTGTCTTCTTGATATGTGATGTGCTTTTTTGT