Detailed information on CNT30694068


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102345Oryza sativaOryza rufipogon10010.7100321forward

Expression of CNT30694068

Peptides detected in this lncRNA

>peptide 1 (35 aa)
SVLHSMKFQSPFLLTHPSQYPNQPLNHVEEHEVSL*

>peptide 2 (28 aa)
MLVAVRFLVLHGQNSGLLVGRQCSWSKNI

Sequence

>CNT30694068
TCTGTTCTTCACTCCATGAAGTTTCAGAGCCCTTTCCTCTTGACACACCCATCCCAGTACCCAAATCAACCACTGAATCACGTTGAAGAACATGAAGTTT
CTCTCTGATTTCTGAAGTCCCAAATGGCGCTATCCTGCATGAGCTTTTGAATGAGTCTTACATATTTGTTCTGCCCTGCCATCTTAAGAAAGGGATGTTT
CATCCTTCTAACATGAGGATGGGAAAATCCTTATGTTAGTGGCTGTCAGATTCTTGGTCTTGCATGGCCAAAACTCTGGCTTGTTGGTAGGTAGGCAGTG
TTCCTGGTCCAAGAATATAGG