Detailed information on CNT30694051


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006993, E-value = 8e-129

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102332Oryza sativaOryza rufipogon17.9625.0298.5399forward
CNT30117052Oryza sativaOryza nivara19.541.5999.31433forward

Expression of CNT30694051

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MSSLLAIFCAFAWNIWFCTTVDYKIQLNRALFSHISHNKLDMENHRL*

>peptide 2 (46 aa)
MIKSVSFSFFSATEYFLIVFYYSMDNACVHAYDGLLIVLHVHNNCN*

>peptide 3 (42 aa)
MESFATFEENEWIIEKLGETSFILRNFENWLRCKPGKYSHPV*

>peptide 4 (39 aa)
LMRSKGYRSKSNPVSCSFCPTPLGPIGAAAQRLPCLSPH*

>peptide 5 (36 aa)
MSFEGQTSCHWVSSAVKDSCLKLMKFLTAGCLLSSL*

>peptide 6 (85 aa)
MDDAAPTQERTPPLPPVSAASSKSRHRRASAACTCCSPKPCSAAGARHRRPPPPTKSNRSFVEVGIAAGSSEASSGHALVSFLSL*

>peptide 7 (56 aa)
MILPIVMRKSGNRQYCFFLIQKAFSSFQQASSSIDFGMIERTKLTSLNEGLVMGQC*

>peptide 8 (85 aa)
DAVKGLQIQIESRFLLLLPDSSRPDWRRRPAPAVPLSPLTSRAPEPPHPTTKPRRRRKSPRFPPPTPVLECMPAGPAVDASEDPR*

>peptide 9 (50 aa)
MMKSSDYLHGLVSCSTNSGNSFSSSEVCIDVIPSSHLLCICLEHLVLHYR*

Sequence

>CNT30694051
TTGATGCGGTCAAAGGGTTACAGATCCAAATCGAATCCCGTTTCTTGCTCCTTCTGCCCGACTCCTCTCGGCCCGATTGGCGCCGCCGCCCAGCGCCTGC
CGTGCCTCTCTCCCCACTGACCAGCCGAGCACCAGAGCCGCCGCACCCCACCACCAAACCGCGCCGCCGTCGAAAATCGCCTAGGTTCCCGCCGCCAACG
CCCGTCCTCGAGTGCATGCCTGCAGGTCCTGCTGTCGACGCCTCTGAAGACCCCCGGTGATGGACGACGCTGCCCCGACGCAGGAGAGGACGCCTCCTCT
GCCGCCGGTGTCCGCCGCCTCCTCCAAGAGCCGGCACCGCCGAGCTTCCGCCGCCTGCACCTGCTGCTCGCCGAAGCCGTGCAGCGCCGCCGGAGCCCGA
CACCGCAGACCACCTCCGCCCACGAAATCCAACAGATCATTTGTCGAGGTTGGAATTGCTGCGGGATCAAGCGAAGCCTCGTCAGGCCATGCCCTCGTCT
CATTCCTCAGTTTATAGAGTCCATTCCAAGCAGAATTGATCCGTCACTTCTGAAGAAACTCCGTTACTTAGCAGAAGCAGAGGCCACAACCTGGCAGCGG
CTGGTCACTTCAGCGGTCTCCAATTGCCTTTGAATACGCCAATGGTAATTTCAAAAATCTCCAAGTAGTCCACTAATTTTATTACTTACATTTTTTTTCA
TCTAAAGCAAAATTGAAAACATATGTTTCCTTGTAATTCTAAATTTGACTGCACATATTTTGATTTTTGATGAGTACTGCTCGATAGATTCAAAGCGGCC
ATGAGTTTTTTTTTTTGAGTTGAAGTGGCAAGAGCATTGCCGAATATATTAGACGAATAGAGTTCACCCTGTTTATAAGGAAAACCGGGCCCAAAAAACA
TACAACTGCCCGGTTTGCTAAAGTGAAACCGGCGAAAACCTTACACAGAAGACACAAAAAGCCTGAGACAAGACAACTACGAACTGTCGGAGGCCGAGGG
ATGAGCAAGACCGTAAGATGAAATCTCCAAGGAGGTGAATAACGACATAAGCCGCTGTCGACGTCCGTCCAAAAACTGGGCTGGTTTTCACCCAGGGGGG
AGGGAGTCCACAAGGCAACACCTCCAGGGAGGAAACGGCACCCGTGGGCGTCGATATTGCCAATCCTAGAACAGGCAGGGCATGAGGTTTTTGGGAACTA
GCAATTATTGATTTTGATTGTTGATGATGAAGAGTTCTGACTATCTACATGGGTTAGTTTCTTGTTCAACAAATTCAGGAAATAGTTTCAGCTCATCAGA
AGTTTGCATCGATGTCATCCCTTCTAGCCATCTTCTGTGCATTTGCTTGGAACATTTGGTTCTGCACTACCGTTGACTATAAAATACAGCTCAACAGAGC
TTTATTTTCTCACATTTCTCATAACAAGTTGGATATGGAAAACCATCGACTCTGAATAGGAGATAGCGAGCTTTGGAATGATTCTGAGATAGCTCCATTT
TTTATCTTGTCTGAACTTTGGCTGTGAGCTCAAATGATTAAATCAGTATCTTTTTCATTTTTTTCAGCCACTGAATACTTTTTAATAGTTTTCTATTATT
CTATGGATAATGCTTGTGTGCATGCTTATGATGGATTGCTAATTGTTTTACACGTGCATAATAACTGTAATTAACTGGGGGAGTGCTTCTTGAGGTAGAT
GGAAAGCTTTGCTACTTTTGAAGAAAACGAGTGGATAATAGAGAAATTGGGTGAGACATCATTTATTCTGCGCAACTTTGAGAACTGGCTGAGATGTAAA
CCTGGGAAATATAGTCATCCCGTGTGAATAACACAAATGAGCTTCGAAGGACAAACATCATGCCATTGGGTCAGTTCTGCAGTTAAAGATAGTTGTCTGA
AATTGATGAAGTTCTTGACTGCAGGTTGTCTTTTAAGCAGTTTGTAGCTTAATAAACGGTTGTGCAGGTGCCATGGTCATACTATTGATCCTGTTAGAAC
AAACAAGATAAAATGGATGTGCCCAACAACTAGACAATACCACATAACTTATGATATTACCGATAGTGATGCGAAAATCAGGGAATAGACAGTATTGTTT
CTTCTTGATTCAGAAGGCGTTCTCCAGCTTTCAGCAAGCCTCATCTTCTATTGATTTTGGCATGATTGAGCGAACGAAGTTAACCTCGCTAAATGAAGGA
CTCGTAATGGGGCAATGTTGA