Detailed information on CNT30694048


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30596441Oryza sativaOryza meridionalis26.0758.6996.95591forward
CNT30109754Oryza sativaOryza longistaminata25.9839.5899.66589forward
CNT30102299Oryza sativaOryza rufipogon29.95100.1599.12679reverse complement
CNT30115975Oryza sativaOryza nivara9.7530.91100221forward

Expression of CNT30694048

Peptides detected in this lncRNA

>peptide 1 (41 aa)
TSPTPTVLGHSCLLPWSPRPCPCARSITSRADFSLLLDLYL*

>peptide 2 (62 aa)
PHPHPLFLAIAAYSHGLLVLALVLDRSPAELIFLFCLISTSDMHLKTGEHLHLPISSGHGYG*

>peptide 3 (37 aa)
MLWVACKEPSMRAMISLSALIQFQTCVVGFVSSRCSC*

>peptide 4 (37 aa)
MVCLDAVGGVQGAKHACHDLSFCLNSVSDMCSWICFL*

>peptide 5 (36 aa)
MRFGLYGNFVTSPCAFVFLFICIYSLLVLEYLLCCV*

>peptide 6 (36 aa)
MLTCMNQQGYSFIICFDSFLSTIILIIFFILGSLGT*

>peptide 7 (29 aa)
MILLQQDKLKHTQVKLLDGRYTCSDGSKS*

Sequence

>CNT30694048
ACCTCACCCACACCCACTGTTCTTGGCCATAGCTGCCTACTCCCATGGTCTCCTCGTCCTTGCCCTTGTGCTCGATCGATCACCAGCCGAGCTGATTTTT
CTCTTCTGCTTGATCTCTACCTCTGACATGCATCTGAAGACCGGAGAGCATCTGCATCTGCCTATATCATCCGGTCATGGATATGGATAGATGACCGGCC
TGTTCATGTCTGAAGAAAAATCAAAGGTTTGGTTTTGATCGGCTTGAGAGCGTGCCTGGCTCCCTGTATGCCACTCATGTAGCCCAATCCATGGTGTGTT
TGGATGCTGTGGGTGGCGTGCAAGGAGCCAAGCATGCGTGCCATGATCTCTCTTTCTGCCTTAATTCAGTTTCAGACATGTGTAGTTGGATTTGTTTCCT
CTAGGTGTTCATGTTAATTACATATTTCATGTTGATTTTGCCCGTTTGGATATGTGTTTGTCTGCTTGGTTTCGAATTGTTTTAGCAGGGGGGCAGAACT
AATCAAGGATACTGCAAATCGTTGGAATTAATTTCTTGTTCAATCTTGATCCAGATAACTATGAGAGCTTTTAATCACAACGAGAAAAGGTAATCTCTCT
CTATCAGCTGCCCCTTTTTCTTCTACTAGTTTATATTTAGATCGCATTCATACTCTTGACTAGCTCGCTGCAGTTTATTTGCATATGTTTTCCCAGCAAG
ATCTAATTAGATACTTAGATGAGATTTGGACTGTATGGTAATTTTGTTACTTCTCCTTGCGCATTTGTATTTCTGTTTATTTGTATTTATTCTCTGCTAG
TACTGGAGTACTTGTTATGTTGCGTGTAATTAATTAAGCAATGTTAATTAAGTAAATTGTTAATGTACATACATACATGAGGTCATTTCTTGGTTTTCGT
CTTGTACTTTAGTTCTTGAATTGTTCACTGGGCTGGCACTTAGAAAAAGCATAACGATTTAGTTTAATTGAGAAATGCCTATGGGTCTTCCCGGCTAGCT
CCATAAGGTTGTCGGCTAGATGACCTGGATTCGAAGCTTCACAACTTCTAATTATTTGATATTAGGTCATTCCCTAATATTCACGTCTTTTTATTTAGTT
TAATTCTTTTTTCAAAGAAAAAACTGACACGTATTTAAATTTCTGCTAGAAATGGCCATCTGTGGGATAGGGATAGAAAGCTTCAGTTACTAGTACACAC
TAGCTAGTTGTTTGTTTGATTTGGCCAAGAAATCTGAAGAGATATGGATTGTGTTCTTTGAAATTCATTACCTTTCTTCACTGTACTTATCGTGTGCGGT
CATCCATGCTTGGACGAATTTCTTCTCTCTTTCTTAAGATCAAAGATTAAGCACCCATCATATTGTGCCTTAAGTACGTAATCCAATAAAGTTCAACATT
AGGTTTGGCTCCTTAATTTGTACACTTAATTATTACATATGCGCTTCCAATTTTTAGATGAATAATGATTCTTTTGCAGCAAGATAAACTTAAACACACA
CAGGTGAAACTTTTAGATGGAAGGTACACTTGCTCTGACGGTAGCAAAAGTTGATCATGCCCTACTTTAGCTGTAACATGAGACATGTCAGCATATGCTT
ACATGCATGAATCAGCAGGGCTACAGTTTTATTATTTGCTTTGACAGCTTTCTCTCAACAATCATTCTCATTATATTTTTTATCCTAGGCTCCTTAGGAA
CATAGTAATTTTACAGGATTTTTGCTGAAATCGATCAGTTCAGTTCCCGCAAAATTCCACTGAAAATTAATCCTCTACTCCAAAGGCCTCTCTCTCTCTC
TCTCTCTCTCTCACGTAGGATTTGCCACTGAGGTCTCAGCATCAATGGTGGCAAATTCTAGGTTTTGATTAATTTTTTAGATAATGAGGTTTTGATTAAT
TAGAAAACTATGCAGTGCATTGTATCAGAATGACAGATATAACATCAATTCATGTAGATAACTAAAGAACCTCTTATATATCTATCTCTGGGGTAGTACT
AGTGATTTAAGTAGTACTGTAATCGGGCTTTGCTGATGCGAACTTCCTCTGAAACTTTTGCTAGCTAAAACCAAAATGCGGGACTGATGATCAGCATGGA
GAGCAGCCTCAATTTATTTGTAGACGCTCAAGATTACTTGCAGATCTGTCAGAAGTAATACTGCCACAATGAGGATGTTTTATGGTTATATAGGCTAAAA
TATATATGAGTAATATTCCATGCATGTCTATCAGCATTGTAACTAGCTATACAGGATAAAAATTCAC