Detailed information on CNT30694013


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004648, E-value = 7e-35

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30108391Oryza sativaOryza longistaminata66.9875.8894.11645forward
CNT30102045Oryza sativaOryza rufipogon55.9756.5695.18539forward
CNT30576728Oryza sativaOryza barthii42.2619.5593.12407reverse complement

Expression of CNT30694013

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MISWTQHCQLVSVILNFSFSNLKLPFAGET*

>peptide 2 (31 aa)
MLCEDSAGEFNTEDPNSSCLAAFVHPLPTYI*

>peptide 3 (38 aa)
MLGSGRIKPTSRAIIQQQPMFSIHSHEYIGKNHAEGIY*

>peptide 4 (42 aa)
MSSLGQFISYLITCCIVSCSLLPATISKIQIEVFKFALNMCT*

Sequence

>CNT30694013
ATGACACTTTCTATATAAGCTGAATGATTTCTTGGACTCAACACTGTCAATTGGTCTCTGTTATCTTGAATTTTTCTTTTTCTAATTTGAAGCTGCCTTT
TGCTGGTGAAACTTAACACTGTCGATTGGACTCACTATGCAGACTGACTTGCAGGCCACATTTGTTAGTCTCAAAATCTGCCGGATCCCTTTGTGAGCCA
GGAAAGATTTCTGCCAATAGGGAACAGAGTTTGACATCTCATTTGGATGAAGTAAACACATGCTTTGTGAGGATTCTGCCGGAGAGTTTAACACTGAAGA
TCCGAATTCAAGTTGCCTTGCTGCATTTGTTCATCCACTGCCTACCTACATATGAAAGTTGGATGCTTAACTGGGCCTGAAACTCTATGCTTGGTTCAGG
CAGAATAAAGCCAACATCGCGGGCTATAATCCAACAACAACCAATGTTCAGCATCCATAGCCACGAATACATAGGGAAAAATCATGCTGAGGGCATCTAC
TGAGTGAAAGGGCCCTGATTCAGATTGGAGGACCATTCACCAATAAGGGAACAACACCATGGACATAAAAATTCAGCTTGATGAGCAGTCTTGGTCAGTT
CATTAGTTACTTAATTACCTGCTGCATTGTTTCGTGTTCCTTGTTACCCGCAACCATTTCCAAAATCCAAATCGAGGTGTTTAAGTTTGCATTGAATATG
TGTACGTAATCGGTTACAGTTTAGAATTTGGAGTTGTACTAGGTATAGGAATAGACTAAGAGTCGGACTCTATTCTAAGATCTCTCTTAAATAGAGGGGC
AGACTTGTGGTAACCGCATGGCGACCGGTCGTGAGTCATTGTAACTCTGATACGCTATAATATGCTGAATCGGGGAGGAGCGCCCATAATCAGTGCCCCA
GGGATGTAGGCTTCGGCTGAACCTCGTTAACAAATATCGTGCCTTGGTATCATCATCATGTTT