Detailed information on CNT30694005


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005380, E-value = 7e-160

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30663028Oryza sativaTriticum dicoccoides17.4421.4992.08101forward
CNT30596432Oryza sativaOryza meridionalis30.2229.0296175forward
CNT30370409Oryza sativaOryza glumipatula56.6542.1198.17328forward
CNT30101990Oryza sativaOryza rufipogon61.8368.06100358forward
CNT30116921Oryza sativaOryza nivara31.0926.95100180forward

Expression of CNT30694005

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MDQSNSGRNRKTRYDMYMTQIINIDNISLNCSSHCY*

>peptide 2 (55 aa)
MEGMVTAAEERAAMVASVLYFFLVCVCVCVCVVLLWFSSSGAGVVVAINQSNDLSS

Sequence

>CNT30694005
TCGCAAATTTAATATAATGTTCCACGCATGGACCAATCGAATTCCGGGCGAAACCGGAAGACGAGATATGATATGTATATGACACAAATCATCAACATAG
ATAATATATCGTTGAATTGTTCGTCTCATTGCTATTGATAATTGATACACACTTGCATACACACAAGAGAAAACTGAGGAACAGATCATCGGTACGTAGT
ATATTCGCGATGGACAAATCGATATATATATATATAGGATAGAGCCGTAGGAGGCATATTTAGATTGAGAAGAAAGAATAATTAGTTGACGGTGACCTTG
CCGACCATCCCAGCTCCGGCGTGCGGCTCGCAGTAGAAGCCGTATGTGCCGGGGACGGTGAGCGTGACGGAGAAGATCTCATCCTCCTCCGCCCGGGAGC
GGAGGGGGCCATGGAAGGGATGGTGACGGCGGCAGAGGAAAGAGCGGCCATGGTAGCTAGTGTATTGTATTTCTTCTTGGTCTGCGTCTGCGTCTGCGTC
TGCGTAGTACTCCTATGGTTCAGCAGCAGCGGCGCCGGTGTAGTGGTTGCTATAAACCAATCCAATGATCTGAGCTCGG