Detailed information on CNT30693983


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000872, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102342Oryza sativaOryza rufipogon85.9687.2999.37790forward

Expression of CNT30693983

Peptides detected in this lncRNA

>peptide 1 (72 aa)
LTSICSFSHCFNQSSHLQSRASAGADNGFSRSSSSQASRLMVIGVGNETSSRPCLRSEQKISQVYKKGEAGM*

>peptide 2 (63 aa)
MSRQYSMNLFPFFTWTEDLIRCCLCFDPLPTCLFFTFFFFCKTLLRARFGYRKTFCETMSTSC*

>peptide 3 (66 aa)
MKSKDATVCFNRNSTTPKSWLSLSRHEGSFEKDILYVYYCCSLISCNQKPYIWFLVYCNYLLLITS*

>peptide 4 (42 aa)
MERHLARVCRRAPELQHVEAVQHESFSFFYVDRRSYSVLFMF*

>peptide 5 (39 aa)
SRPFAHFLTALIRAAICSREHQQARIMASAALPHPRRLA*

>peptide 6 (29 aa)
MRARSRRIFSMFIIVVVSFLVTKNLIFGS*

Sequence

>CNT30693983
CCTCACGTCCATTTGCTCATTTTCTCACTGCTTTAATCAGAGCAGCCATTTGCAGTCGAGAGCATCAGCAGGCGCGGATAATGGCTTCAGCCGCTCTTCC
TCATCCCAGGCGTCTCGCCTGATGGTCATCGGCGTGGGGAACGAGACCAGCAGCCGCCCGTGTTTGAGATCCGAACAGAAGATTTCTCAAGTGTACAAAA
AAGGAGAAGCCGGCATGTAAGGTTTAGATATGGAAAGACATCTTGCAAGAGTATGCCGACGAGCTCCAGAACTACAGCATGTCGAGGCAGTACAGCATGA
ATCTTTTTCCTTTTTTTACGTGGACAGAAGATCTTATTCGGTGTTGTTTATGTTTTGACCCTCTCCCAACATGCTTGTTTTTCACTTTTTTTTTTTTTTG
CAAGACACTTCTGCGTGCAAGGTTTGGATATAGGAAGACATTTTGCGAGACTATGTCAACGAGCTGCTAAAGTACAACATCGGATGCCCCCATAATCCCT
TCAGAGCAGTTATCGATTCTTTGAAGGTTGTGGAGGAGAAAAATCGCCAGCTTGTTCTTCTTCAAGATGAAATCGAAAGATGCCACCGTTTGCTTCAACA
GAAATTCGACGACACCGAAGTCCTGGTTGAGCCTCTCGCGTCATGAGGGCTCGTTCGAGAAGGATATTCTCTATGTTTATTATTGTTGTAGTCTCATTTC
TTGTAACCAAAAACCTTATATTTGGTTCCTAGTTTATTGTAATTATTTGTTACTAATAACTTCTTAGCGTCCAGTGTAGTATCATGGTAATCGCCGTGTT
ACTAGGGGGCGACAATCGTATTGTGGCAGATATAAGCCAAGTTAATTAAGGTGCAAATTTGATGTGTTAATAGCAGTGTGCAGTGTGCTCAGAATTTTTG
GACAACTACAGCATTTCGT