Detailed information on CNT30693916


BLAST search results

BLAST vs Swiss-Prot:
sp|P69322|UBIQP_PEA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 6e-175

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674319Oryza sativaSetaria viridis54.9282.2587.68820forward
CNT30641270Oryza sativaNymphaea colorata76.6257.2982.691144forward
CNT30191758Oryza sativaSecale cereale73.2171.77861093forward
CNT30226205Oryza sativaHordeum vulgare64.993.985.55969forward
CNT30242826Oryza sativaAvena sativa60.3572.0888.24901forward
CNT30311152Oryza sativaCamelina sativa73.8868.3882.591103forward
CNT30461176Oryza sativaSaccharum spontaneum59.1425.986.75883forward
CNT30140803Oryza sativaLolium perenne76.9664.1987.121149forward
CNT30229013Oryza sativaAnanas comosus76.4972.4283.891142forward
CNT3067522Oryza sativaLeersia perrieri60.4272.9885.14902forward
CNT30652285Oryza sativaRosa chinensis61.0974.9484.54912forward
CNT30716337Oryza sativaMalus domestica golden71.1385.7184.371062forward
CNT30684712Oryza sativaTriticum urartu76.7644.7887.611146forward
CNT30722465Oryza sativaTriticum spelta55.7373.6988.34832forward
CNT30348745Oryza sativaEragrostis tef74.2899.8285.031109forward
CNT30596296Oryza sativaOryza meridionalis91.3699.0695.091364forward
CNT30110940Oryza sativaOryza longistaminata87.4148.1296.931305forward
CNT30116770Oryza sativaOryza nivara93.6410099.571398forward

Expression of CNT30693916

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MSLCWSGGMPSLSWIFAFTLSMVSELSTSRVIVLPVRVLTKICIPPLRRRTR*

>peptide 2 (47 aa)
MTQQMFGQQYSTFKRTRWSTNSTNKVFTRIMQTQDNSTAAIPSINDY*

>peptide 3 (52 aa)
MRRCWSGGIPSLSWILAFTLSMVSEDSTSRVMVLPVRVFTKICICKNVYQPW*

>peptide 4 (37 aa)
MVSELSTSRVMVLPVRVLTKICIPPLRRSTKCRVDSF*

>peptide 5 (44 aa)
MPSLSWIFAFTLSIVSDDSTSSVMVLPVRVFTKICIPPLRRRTR*

Sequence

>CNT30693916
TAGCAGCACGCAGGCACTTTAATCTGAAATGTAGGCAAATTTGAATGAAGAGTTGTAATGGGTGCAGAACTATAAGCAAATTTAGCAACGCAGATTAATA
GTTTACTTATTAATTAGTTTAAACTGCTATGACCCAGCAAATGTTCGGACAGCAGTACAGCACATTTAAACGGACTCGATGGTCCACTAACAGCACAAAT
AAAGTTTTCACGAGGATAATGCAGACACAGGATAACAGTACAGCAGCAATTCCATCAATCAATGATTACTGACCACCCCTGAGGCGGAGCACCAGGTGGA
GGGTAGACTCCTTCTGAATGTTGTAGTCGGCGAGGGTACGGCCATCTTCCAGCTGCTTGCCGGCGAAGATCAGGCGCTGCTGGTCTGGGGGAATACCTTC
CTTGTCCTGGATCTTAGCCTTCACATTGTCGATGGTATCGGAGCTCTCAACCTCCAGAGTAATGGTCTTGCCAGTAAGAGTCTTGACGAAGATCTGCATA
CCACCCCTGAGGCGGAGCACCAAGTGTAGGGTAGACTCCTTCTGAATGTTGTAGTCGGCAAGGGTGCGGCCATCCTCCAGCTGCTTACCAGCGAAGATGA
GTCTCTGCTGGTCCGGGGGGATGCCCTCCTTATCCTGGATCTTCGCCTTCACGTTGTCAATGGTGTCTGAGCTCTCAACCTCCAGGGTAATAGTCTTGCC
AGTGAGAGTCTTGACGAAAATCTGCATTCCACCCCTTAGGCGCAGAACAAGGTGAAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCGAGGGTCCTGCCA
TCCTCCAGCTGCTTGCCGGCAAAAATAAGACGCTGCTGATCTGGGGGAATGCCCTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCGATCGTGTCTGATG
ACTCAACCTCAAGCGTAATGGTCTTGCCAGTAAGGGTCTTCACGAAGATCTGCATTCCTCCCCTTAGGCGGAGAACAAGGTGAAGGGTGGACTCCTTCTG
GATGTTGTAGTCAGCAAGGGTCCTACCATCCTCGAGCTGCTTGCCAGCAAAGATCAGACGCTGCTGGTCCGGGGGAATCCCTTCCTTGTCCTGGATCTTT
GCCTTAACGTTGTCAATAGTATCAGAAGACTCAACCTCAAGGGTGATAGTCTTGCCAGTCAAGGTCTTGACAAAGATTTGCATGCCTCCCCGGAGGCGGA
GGACAAGGTGGAGGGTGGATTCCTTCTGGATGTTGTAGTCAGCAAGCGTGCGCCCATCTTCAAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGG
TGGGATTCCCTCCTTGTCCTGGATCTTGGCCTTTACATTGTCAATGGTATCCGAGGACTCAACCTCAAGGGTTATGGTCTTGCCAGTGAGAGTCTTCACA
AAGATCTGCATCTGCAAGAATGTATATCAACCATGGTAAGTCTCCAGTATATACAAGATTATAAGGGAACCAGGATCAAGCAAACAAATGTTA