Detailed information on CNT30693865


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 9e-149

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30528977Oryza sativaEucalyptus grandis71.367.3185.81902forward
CNT30553671Oryza sativaOryza glaberrima92.02100.0999.481164forward
CNT30143309Oryza sativaLolium perenne72.9676.8587.54923forward
CNT307928Oryza sativaZea mays72.9677.4386.57923forward
CNT30368619Oryza sativaSorghum bicolor71.8678.7785.37909forward
CNT30370352Oryza sativaOryza glumipatula93.610098.651184forward
CNT30706353Oryza sativaPrunus avium71.0750.9384.32899forward
CNT30576485Oryza sativaOryza barthii73.299.3696.87926forward
CNT30116852Oryza sativaOryza nivara93.9110099.491188forward
CNT30593897Oryza sativaEragrostis curvula72.8982.186.77922forward
CNT30174646Oryza sativaVigna angularis67.9882.5385.23860forward

Expression of CNT30693865

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MVSELSTSRVMVLPVRVLTKICIPPLRRSTKCRVDSF*

>peptide 2 (52 aa)
MSLCWSGGMPSLSWIFAFTLSMVSELSTSRVIVLPVRVLTKICIPPLRRRTR*

>peptide 3 (47 aa)
MTQQMFGQQYSTFKRTRWSTNSTNKVFTRIMQTQDNSTAAIPSINDY*

>peptide 4 (52 aa)
MRRCWSGGIPSLSWILAFTLSMVSEDSTSRVMVLPVRVFTKICICKNVYQPW*

Sequence

>CNT30693865
TAGCAGCACGCAGGCACTTTAATCTGAAATGTAGGCAAATTTGAATGAAGAGTTGTAATGGGTGCAGAACTATAAGCAAATTTAGCAACGCAGATTAATA
GTTTACTTATTAATTAGTTTAAACTGCTATGACCCAGCAAATGTTCGGACAGCAGTACAGCACATTTAAACGGACTCGATGGTCCACTAACAGCACAAAT
AAAGTTTTCACGAGGATAATGCAGACACAGGATAACAGTACAGCAGCAATTCCATCAATCAATGATTACTGACCACCCCTGAGGCGGAGCACCAGGTGGA
GGGTAGACTCCTTCTGAATGTTGTAGTCGGCGAGGGTACGGCCATCTTCCAGCTGCTTGCCGGCGAAGATCAGGCGCTGCTGGTCTGGGGGAATACCTTC
CTTGTCCTGGATCTTAGCCTTCACATTGTCGATGGTATCGGAGCTCTCAACCTCCAGAGTAATGGTCTTGCCAGTAAGAGTCTTGACGAAGATCTGCATA
CCACCCCTGAGGCGGAGCACCAAGTGTAGGGTAGACTCCTTCTGAATGTTGTAGTCGGCAAGGGTGCGGCCATCCTCCAGCTGCTTACCAGCGAAGATGA
GTCTCTGCTGGTCCGGGGGGATGCCCTCCTTATCCTGGATCTTCGCCTTCACGTTGTCAATGGTGTCTGAGCTCTCAACCTCCAGGGTAATAGTCTTGCC
AGTGAGAGTCTTGACGAAAATCTGCATTCCACCCCTTAGGCGCAGAACAAGGTGAAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTCCTACCA
TCCTCGAGCTGCTTGCCAGCAAAGATCAGACGCTGCTGGTCCGGGGGAATCCCTTCCTTGTCCTGGATCTTTGCCTTAACGTTGTCAATAGTATCAGAAG
ACTCAACCTCAAGGGTGATAGTCTTGCCAGTCAAGGTCTTGACAAAGATTTGCATGCCTCCCCGGAGGCGGAGGACAAGGTGGAGGGTGGATTCCTTCTG
GATGTTGTAGTCAGCAAGCGTGCGCCCATCTTCAAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGGTGGGATTCCCTCCTTGTCCTGGATCTTG
GCCTTTACATTGTCAATGGTATCCGAGGACTCAACCTCAAGGGTTATGGTCTTGCCAGTGAGAGTCTTCACAAAGATCTGCATCTGCAAGAATGTATATC
AACCATGGTAAGTCTCCAGTATATACAAGATTATAAGGGAACCAGGATCAAGCAAACAAATGTTA