Detailed information on CNT30693848


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101654Oryza sativaOryza rufipogon75.9399.37100634forward
CNT30576360Oryza sativaOryza barthii57.96100100484forward
CNT30116839Oryza sativaOryza nivara75.6999.2299.68632forward

Expression of CNT30693848

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MSISIEKGRQRGKRSELKRYSVPHFLLLPFP*

>peptide 2 (41 aa)
MTIYMVHMYKYSAINMNWTRTESLFLALNIYFYNLRYHLLP*

Sequence

>CNT30693848
GTTTCAGTCATTTGTTAATTGCTACAAAAACCTGTGTGTGTGCACTTCTTTGTGTTTATCTCCATTGAGCCATAGAGAGAAAAGCTGAGTGCGCGTGCGT
CGCCATTGTCGTGTCCACTACAATTTGCCACTTGTGCGTGTGTGCCATCGCTTGAGTTCGCTGCTCGCCGCGGAGCCTAAGTCAGGACTAGTCATACTGA
CATGCCAAGAGAAGACTGAAGCGAATCATGCATGAAGCGAAGCAATCGCTGATCCTGACATTGTCCCTGCCGGCAGAACATGTTCTCTGATACCTCCTAT
GTCTATTTCAATCGAGAAAGGAAGGCAGAGAGGTAAAAGAAGTGAATTAAAAAGGTACTCTGTTCCTCACTTTCTCCTTCTGCCATTCCCATAAGAATCA
CCAAATAACATGGAATTCAGGCAGTGTTGGTTACTCTCTGTCAATGACCATATATATGGTCCATATGTATAAATACTCGGCAATCAACATGAACTGGACA
AGGACTGAGTCATTGTTTTTAGCCCTTAACATTTACTTCTACAACTTAAGGTACCATCTTTTGCCATAACGAAGAACTTAAGACTCCATTTTAAAGGAAG
ATCAAGGGGCAAGACATTGAACCTTTTGTGTGGGGTTATATTTCATCTCATTGGCAGAATATTTTTTTCCTTTGTTTTTACATAATTCAGAAGAAGAGTG
CCATGTGCTCAAGGAAATATAAGTCCAATAGTAGTTCAATTGGTTAGCTTTTCAGTAATATTTATTCTGCTTTTTGATATTTGAGAGATACCCATGGATA
ATGCTTGCTGCCTCCTTCTTGAACATAAATTCTAG