Detailed information on CNT30693836


BLAST search results

BLAST vs Swiss-Prot:
sp|Q4JL84|MYB59_ARATH, E-value = 5e-24

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30596213Oryza sativaOryza meridionalis77.2456.4590.53950forward
CNT30370278Oryza sativaOryza glumipatula74.9688.7498.92922forward

Expression of CNT30693836

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MHACLHLLVKYCIIHRSSTASRLINFDHATPHVNLRMHICKSHHIDPHN*

>peptide 2 (42 aa)
MDGYMHVWVLHDKRERKKNKNKNNQEEKKKERKRSSRWMDGCL

>peptide 3 (40 aa)
MDICMCGCCMIRERERRTRTRTIKKRKKKKEKEAVDGWMDV

>peptide 4 (35 aa)
MHASKSIHSEFQIKKESLAVAKLVYMKKKLNVIRG*

>peptide 5 (32 aa)
MWVRQKFLISLSVRPGRLRAMRDQRLPHWEWR*

>peptide 6 (58 aa)
MQHRMLIYACIYVKAITSIPTTENGTFMCRHLNQFRVSDEYQILFYQYAYLNQFQSSR*

Sequence

>CNT30693836
GTCGTCGATCGATCGTCAGCTAATTAAGCTAAGAGCAGCAATTGAATTAAGGCGTTGCTTGTTTGCAATTTGAGTAGTACTATTGCGAGGCATCGAGCAT
CTTCTTGTAGTACTCCTCGTCGTCGATCCTCCACAGCGAGTAGTCGGTGCAGAATTCCCAGACCGGCGACGGCGGCGAGGCCATCGCCGCCGCGTCGTAG
CAGCTCAGCTGGTCCATGGTGTAGTCCATCGTCAGCAGCTGGCTCGCCGGCGTGGTGGCCGCCGCCACCAGCTGGTCGACGGCCTCGTCGTCGCCGCCGC
AGCTGCTGCTTTCTTGCAGCGCCGCAGCCGTCGCCATCGTCGTCGTCGCCGTGGTGAGCGAGGAGGACAAGGAACCGGAGGAGGTCGTCGGCGCCGGCGA
TGGTGAATTGGTCTTCTTCTTGGCGTGGTGGGCGATCTTGCGCATGTGGGTTCGCCAGAAGTTCTTGATCTCGTTGTCGGTGCGGCCGGGGAGGCTGCGG
GCGATGCGGGACCAGCGGCTGCCCCACTGGGAGTGGAGGTAGTTCACCCACCGGAGACGGCAGCTCTTGCCTGTGCGCTTCAAACCTGAAAGGTGAAACC
ACCAAGGCCAACATGTGCCAGGGAGACAGCCATCCAGAGGAGGAGGAAGAAGAAGAAGAAGAAGAAGCAGATGGTTAACACCTCAGTTTCCCGTGCGTTC
TAAGCTCATGCATGCATGCCTCCATCTCCTAGTTAAGTACTGTATCATCCATCGATCATCGACCGCCTCTAGATTAATTAACTTCGATCATGCAACACCG
CATGTTAATTTACGCATGCATATATGTAAAAGCCATCACATCGATCCCCACAACTGAAAATGGAACATTTATGTGTAGGCATCTTAACCAATTCAGAGTT
TCAGATGAATATCAAATTTTGTTTTATCAATATGCATATCTAAATCAATTTCAGAGCTCCAGATAAAAAGAAATCAATTATTTGTATTGATGCATGCATC
TAAATCAATTCATTCAGAGTTTCAAATAAAAAAAGAATCATTAGCTGTTGCCAAATTGGTATATATGAAGAAGAAATTAAATGTGATAAGGGGATAGATG
GATGGATGGATATATGCATGTGTGGGTGTTGCATGATAAGAGAGAGAGAAAGAAGAACAAGAACAAGAACAATCAAGAAGAGAAAAAAAAAGAAAGAAAA
AGAAGCAGTCGATGGATGGATGGATGTTTG