Detailed information on CNT30693833


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553643Oryza sativaOryza glaberrima10097.5299.52630forward
CNT3067518Oryza sativaLeersia perrieri28.8934.2785.71182forward
CNT30596240Oryza sativaOryza meridionalis79.5294.5397.41501forward
CNT30370327Oryza sativaOryza glumipatula10098.4499.68630forward
CNT30108575Oryza sativaOryza longistaminata88.4193.9397.85557forward
CNT30101831Oryza sativaOryza rufipogon10098.1399.68630forward
CNT30576567Oryza sativaOryza barthii10098.5999.68630forward
CNT30116760Oryza sativaOryza nivara10099.0699.68630forward
CNT30604159Oryza sativaOryza punctata35.5642.2688.84224forward

Expression of CNT30693833

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MDSNNKNLQPPPGYPTVDSEHGGRGRTTARGRKTRFIDGCIAALCCCWLCDLCCD*

>peptide 2 (35 aa)
MDASPHYAAAGCVTFAAIRGRETDEIKRCLDIICG*

Sequence

>CNT30693833
TTCAAACAACACAAATTTGACAAAGAAATTAACGCAGCTAGCTACTTGATCAAAGAAACCTCTCCTTGATCTAGTAGTGCGAGCTAGCTAGCTATAAATT
CGCAGTAGAACGCAGCCAGTGTGTAGCTAGCATGGACAGCAACAACAAGAACCTGCAACCACCACCAGGCTACCCGACGGTGGATTCAGAGCACGGCGGC
CGCGGACGAACGACGGCTCGCGGGAGAAAGACCAGATTCATCGATGGATGCATCGCCGCACTATGCTGCTGCTGGCTGTGTGACCTTTGCTGCGATTAGA
GGAAGGGAAACAGATGAGATTAAAAGATGCCTTGATATTATATGTGGATAGTATTTCTACATGGGTGTGCTGAAAAGAGGATCTTTGGAGCAGAGAATTG
AATACAACGAAATGTTGTTGCAGAAAGTATACATCCCGTAATTTCTGCGTATATTTTCGATATATATATAGCGCGGAATAATGAATAATGATATGCGTGA
AGTATCTATGTAATTCATTAATTACATAGTGTGCTCGTTTTGATTTGTATCCATTTTTCAGCTCATTTATTTTGACCCATATAAAAATGTATAGATAATC
TGATTCCTCAATTGATGAGTTAATCTTTCC