Detailed information on CNT30693805


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553860Oryza sativaOryza glaberrima41.7842.44100160forward
CNT30682490Oryza sativaTriticum urartu17.4922.6488.0667forward
CNT30349660Oryza sativaEragrostis tef20.8920.4191.2580forward
CNT30370372Oryza sativaOryza glumipatula51.4429.36100197forward
CNT30101793Oryza sativaOryza rufipogon49.8745.05100191forward
CNT30576573Oryza sativaOryza barthii44.6561.96100171forward
CNT30116833Oryza sativaOryza nivara10059.66100383forward
CNT30556906Oryza sativaPanicum hallii20.6313.6289.8779forward

Expression of CNT30693805

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MMIDDPSKLARDPSNIDRHTHTLTTTTTVLFRRQSKRQAN*

>peptide 2 (42 aa)
MQPGDDDDRFSCRSSRSSRCSWCHTCRCCSRSRRSRRSPPPSP

Sequence

>CNT30693805
TGAAAGCAGAGGTAGATTATATTAAGAAGCCTGGCACGCATGAGGAGATGGAGCAGGAGTACATGATGAGATCACCATGATGATAGATGATCCATCCAAG
CTAGCTAGGGATCCATCCAACATTGATCGACACACGCACACACTGACAACGACGACGACGGTTTTATTTAGGCGTCAGAGCAAAAGGCAAGCAAATTAAG
GCCTCGATCAAAGCTCTGATCGACAGTAGCAGCATCCATACGATAAATCCTCATGCAGCCGGGCGACGACGACGATAGATTCAGTTGCAGGAGCAGCAGG
AGCAGCCGCTGCAGCTGGTGCCACACTTGCAGGTGTTGCAGCCGCAGCCGCCGTTCTCGCCGCTCTCCACCGCCATCTCCATT