Detailed information on CNT30693795


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 3e-158

BLAST vs NONCODE:
NONMEST001181, E-value = 4e-113

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553813Oryza sativaOryza glaberrima97.7100.1199.47936forward
CNT30604138Oryza sativaOryza punctata77.5687.8394.75743forward

Expression of CNT30693795

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MSLCWSGGMPSLSWIFAFTLSMVSELSTSRVIVLPVRVLTKICIPPLRRRTR*

>peptide 2 (47 aa)
MTQQMFGQQYSTFKRTRWSTNSTNKVFTRIMQTQDNSTAAIPSINDY*

>peptide 3 (43 aa)
MRRCWSGGIPSLSWILAFTLSMVSEDSTSRVMVLPVRVFTKICI

Sequence

>CNT30693795
TAGCAGCACGCAGGCACTTTAATCTGAAATGTAGGCAAATTTGAATGAAGAGTTGTAATGGGTGCAGAACTATAAGCAAATTTAGCAACGCAGATTAATA
GTTTACTTATTAATTAGTTTAAACTGCTATGACCCAGCAAATGTTCGGACAGCAGTACAGCACATTTAAACGGACTCGATGGTCCACTAACAGCACAAAT
AAAGTTTTCACGAGGATAATGCAGACACAGGATAACAGTACAGCAGCAATTCCATCAATCAATGATTACTGACCACCCCTGAGGCGGAGCACCAAGTGTA
GGGTAGACTCCTTCTGAATGTTGTAGTCGGCAAGGGTGCGGCCATCCTCCAGCTGCTTACCAGCGAAGATGAGTCTCTGCTGGTCCGGGGGGATGCCCTC
CTTATCCTGGATCTTCGCCTTCACGTTGTCAATGGTGTCTGAGCTCTCAACCTCCAGGGTAATAGTCTTGCCAGTGAGAGTCTTGACGAAAATCTGCATT
CCACCCCTTAGGCGCAGAACAAGGTGAAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTCCTACCATCCTCGAGCTGCTTGCCAGCAAAGATCA
GACGCTGCTGGTCCGGGGGAATCCCTTCCTTGTCCTGGATCTTTGCCTTAACGTTGTCAATAGTATCAGAAGACTCAACCTCAAGGGTGATAGTCTTGCC
AGTCAAGGTCTTGACAAAGATTTGCATGCCTCCCCGGAGGCGGAGGACAAGGTGGAGGGTGGATTCCTTCTGGATGTTGTAGTCAGCAAGCGTGCGCCCA
TCTTCAAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGGTGGGATTCCCTCCTTGTCCTGGATCTTGGCCTTTACATTGTCAATGGTATCCGAGG
ACTCAACCTCAAGGGTTATGGTCTTGCCAGTGAGAGTCTTCACAAAGATCTGCATCTG