Detailed information on CNT30693744


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553866Oryza sativaOryza glaberrima56.7933.2198.85347forward
CNT30370371Oryza sativaOryza glumipatula32.7330.8295200forward
CNT30576353Oryza sativaOryza barthii56.7930.198.85347forward
CNT30116857Oryza sativaOryza nivara61.8752.6599.47378forward

Expression of CNT30693744

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MRTYRMFLYSAIVMALVQESGVHHGAKIWESSC*

>peptide 2 (34 aa)
ASSLSMLLIYYYYNKIKIPHLDLDELRQIPPLYG*

>peptide 3 (47 aa)
MNSARFRRFTGELEHRLPEQSIVSSSPPLIKRLAAELELMHGSARAN*

>peptide 4 (57 aa)
MMMMMMMMGAEVSSKNANVPHVPVFCNCDGIGSGIGSSSWCQDLGEFLLVWRRNLCR*

Sequence

>CNT30693744
AGGCATCGTCTCTCTCCATGCTGCTGATCTACTATTACTACAACAAAATAAAAATTCCCCACCTTGACCTAGATGAACTCCGCCAGATTCCGCCGCTTTA
CGGGTGAGCTCGAGCACCGCTTGCCCGAGCAGTCGATTGTCTCGAGCTCGCCACCACTGATCAAGCGCCTTGCCGCTGAGTTGGAGCTGATGCATGGTTC
AGCTCGTGCAAATTAATCAATGTCCAGCTGCATCAAAGTGCATGAGCTTGGATCGAGAAGGTCCATGATGTGATCGATGCTAACATCGTCAAGTATTACG
CCAACCTGTGGATCCAATCCAGCCCGTGTGACTTGATTTTGTTCAGCCATCAGAGGGATCTGTGGACTCAGCAGGATTTGATGATGATGATGATGATGAT
GATGGGGGCAGAAGTATCATCCAAGAATGCGAACGTACCGCATGTTCCTGTATTCTGCAATTGTGATGGCATTGGTTCAGGAATCGGGAGTTCATCATGG
TGCCAAGATTTGGGAGAGTTCTTGTTAGTGTGGAGACGCAATCTGTGTAGATGAAAATAAAACAACTGTGTATTTGTACTTATGTACCGCTCTAATCCTT
TTTCCCGCCAC