Detailed information on CNT30693719


BLAST search results

BLAST vs Swiss-Prot:
sp|Q84MA2|IP5P1_ARATH, E-value = 8e-124

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3067415Oryza sativaLeersia perrieri2.9625.6891.2357forward

Expression of CNT30693719

Peptides detected in this lncRNA

>peptide 1 (36 aa)
RPSAEELACTIKYIYFHSSSIFFRYQMILNLCIRKC*

>peptide 2 (40 aa)
MTQYSLRRAKSRKWVKYCSSEDFFNICISFQFIAILFSRS*

>peptide 3 (40 aa)
MCFRKSLRTHIERYIPTICLLTIRRKHGLLLLITPLSLLT*

>peptide 4 (56 aa)
MNSSVGSSTEVFICFIMNYIIVNSYIIILFNQWMKLTIIVTVRLAKQFIFHHHNII*

>peptide 5 (52 aa)
MPCCPYNPLHLHRQLILSNSECASASLSEPILKDIFPPFACLLFAESMAFYF*

>peptide 6 (57 aa)
MEQFLEIQEHKYQPAPPYPTSLECPDHWVETCLQDSIKFYTAIPEFSDVNILSAKGL*

Sequence

>CNT30693719
GCGACCTTCAGCTGAAGAACTTGCCTGCACAATCAAATATATATATTTTCACTCAAGTTCTATCTTCTTCCGTTACCAGATGATACTCAACCTCTGCATC
CGTAAATGTTAATGCTTTCTGCAACTTTCTGTGGCAGAGAACCTCAACATCTGCCATGAAGACTGCAGTCACAGGGCGGTGATCAGAAAGCTTAAGCTCT
CCTCTCCTGTAGGAAATTAACCTGATTCCCTTTCCTCTGCTATGAAAAACTAACATACCATGCTGGTGTTCTCCTTCCAGATTTTGGCTCATCACTTACA
TACTTTTCTGAGTCAAACTCGTATTTATATGTTGGGGGGAAGCTGATATCTCCTTCGATCCAACCATCAAAAGTGTGTCCTTTACTCAATTCTCTTTTTA
GCTGATCATTCTCAAACAATCCATCCCAATCTTGCTTGGAGATAAGTTCATGTGCTCTTTCATATGATAAGTTGATTCGGTAGTTGAGATCTCCAAACCA
TATGATCCTTTCATGACCCAATATTCCCTTAGGCGTGCTAAGTCCAGGAAGTGGGTTAAATACTGTTCTTCGGAGGATTTCTTCAACATCTGCATTTCTT
TTCAGTTCATCGCCATCCTTTTCTCCAGAAGTTAGGTGGCAACATACAAAGCAAAAATGTGTCTGATGTATAGACATGCTGACTGATATTGATGCCTTGT
TGCCCATATAACCCATTGCACCTACACCGACAGTTGATACTCTCAAATTCTGAATGTGCTTCCGCAAGTCTCTCCGAACCCATATTGAAAGATATATTCC
CACCATTTGCTTGCTTACTATTCGCAGAAAGCATGGCCTTTTACTTTTAATCACTCCATTGTCACTGTTAACTTGATGGGATAAATCATCATTTGGAAAA
TTCACTGTTGATTTCAAAGATGCTGGAGTTGCTAGAGCCTTCAGTGAATTGGGGGACTGATCAGAAGTCTTTACTGAATCCATCCTGCTGAAATCTTTGC
CTTTATGAACTCTTCCGTTGGAAGCAGCACTGAAGTTTTCATATGTTTTATCATGAACTACATCATTGTCAATAGCTATATCATCATTTTGTTTAATCAA
TGGATGAAGCTCACCATAATTGTCACTGTCAGACTCGCTAAGCAATTCATCTTTCATCACCATAACATAATCTGATGGATTAAACCTTGATGGTGAAGGA
GGATCACTGTGACATTTATACTGCGGCTTATCTGGACAAATCTTATTCAAAGTTTCACGAATAATATGCTCCCATACTGCAATTGGACTGTTATCCTCAG
AACCAAATATGTTTCCAGCATTTAATGGAACAATTTCTTGAAATCCAAGAACATAAATATCAGCCTGCTCCTCCTTATCCAACCAGTCTTGAATGTCCAG
ATCACTGGGTGGAAACTTGCCTGCAAGATTCCATAAAATTCTATACGGCTATACCTGAGTTCTCTGATGTCAATATACTGAGCGCGAAGGGTCTCTGATT
TGCGTCTTCTAAGCCTGTAAGGCATAGATTTAATTTCATCCCCTACATTGTACAAGAGCAAAGCTTGAGTAAACTGGATCAAATCAGAGCAGCTAGGAAG
GAAGAGGAGAGGGGACGGTGACTCGGTGAGGCAGGTTAACCTTCGCCGTCGAGCTCGCCGTCGCTGGCGTCGCACTCGTCGGCGCTGAAGTCGGAGTCGC
CCGACCCGGAGCCGACGTTGAGCCACTTGCGAAGCACCACCCTGCGCCACAGCCGCAGCGCGCCGCACCAGCAATCCACGCCGCAGCACAGCATCATCAA
CTGGTACCTGGTTCTCCCTCCTGCCCCCGCACCGCATCTGGGACGCGGCCATGGCTGGCTCCTGGAGCTGGTGGCCTCGGCGAGGTAGGAGCGGCGACGA
GGCGGAGGAGGAAGAGGACGCCATT