Detailed information on CNT30693680


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30116727Oryza sativaOryza nivara62.5789.9199.78891forward

Expression of CNT30693680

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MASAGLSSSLPATAARVLGKFFLNIPTTGAHCQIFSTKYY*

>peptide 2 (46 aa)
MATSPSESATCLLLHFGTTTTTFPWPVLASHPPYLPLLLECSVSSS*

>peptide 3 (43 aa)
MRSGQTAYGAVHMMFSSVCKSSWLPKLVGRGSNAQIHLNCSCF*

>peptide 4 (47 aa)
MKRGADTLRWLLLRLSLRPASCSTLVPPPPHSHGQCWPLILPTCHCC*

>peptide 5 (57 aa)
LLRAVGCNLQLVDAGFDSDRLTLSSPRRTRSASASLARHGEWGGRNCTRACRCLGVE*

>peptide 6 (61 aa)
MRISTVREEGTPAEETGTATATAILVEVVVYEGAVQHHILTVPAVPHTSLLPLLLSCDAKT*

>peptide 7 (69 aa)
MGREELYSCLSVPRGGVGLIRVGGCSSYRCRLLGPLTLAVEGAAGGEVVETSSAVNAPLHHAQRCASLP*

>peptide 8 (42 aa)
MENGEGGIVLVPVGASGWSRINQSWGVLLVSLSATRPSDFSS*

Sequence

>CNT30693680
GCTCCTCCGCGCGGTAGGCTGCAACCTGCAGCTCGTCGACGCCGGCTTTGATTCCGATCGTCTCACCCTCTCCTCTCCTCGCCGCACCAGATCCGCATCG
GCATCGTTGGCTAGGCATGGAGAATGGGGAGGGAGGAATTGTACTCGTGCCTGTCGGTGCCTCGGGGTGGAGTAGGATTAATCAGAGTTGGGGGGTGCTC
CTCGTATCGTTGTCGGCTACTCGGCCCTCTGACTTTAGCAGTTGAAGGTGCTGCCGGCGGCGAGGTGGTCGAAACCTCCTCGGCGGTCAATGCTCCCCTC
CACCACGCCCAGAGATGCGCATCTCTACCGTGAGGGAGGAGGGCACGCCAGCTGAGGAGACAGGGACGGCGACCGCAACGGCCATCCTGGTGGAGGTGGT
AGTGTACGAAGGAGCCGTGCAGCACCATATCCTCACTGTCCCTGCAGTTCCCCACACGAGCCTGTTGCCTCTATTGCTGTCCTGCGACGCCAAGACATGA
AAAGAGGCGCCGACACCCTGCGATGGCTACTTCTCCGTCTGAGTCTGCGACCTGCCTCTTGCTCCACTTTGGTACCACCACCACCACATTCCCATGGCCA
GTGCTGGCCTCTCATCCTCCCTACCTGCCACTGCTGCTAGAGTGCTCGGTAAGTTCTTCCTAAATATACCGACGACGGGTGCTCATTGCCAAATCTTCAG
CACTAAATATTATTAGGTTGGTAGAGTAATAATCTCCTTTCAGCACTTATCTTTCAGATCTGTGTGTACTGCATGGCATTATTTTTCCTAGGTGAGAAGT
GATATTAAACTTATCTAAAGCCATCGAGCAACAAACTTATACCACTTCCTAATTTTGTCCAGCTGTTCATATGTCACACTCTTTATATCTGAAGCTGTTT
TTGTAAAGGCAGTGTTCTATGATTATAGAAGTAACTATTTATTCATTTTCTGGTATATGTATGACTCCATGTTAGCTTGACCAACAATAAAATGGATTTA
CACTTATGAATATTTTCACTGTATTCTTTTTCTTGATAGGAGCGCAATCAACAATAGAACCGTGTTGAATGTACCAGACAATGGTATGGCCATGCAGGTC
CCATGAATATATTCTTTTTGCTACCAGCTAGAGGGATCTGATGTACACCAGTTCCATCAGATACTCACCTGCGCTGTTCAGGTTTTCCTAGTCAATCGGC
TTATTTGCTATGTTATGAGGAGTGGTCAAACTGCCTATGGTGCCGTTCATATGATGTTTTCTTCTGTTTGCAAGAGTTCCTGGTTGCCCAAGCTTGTTGG
TAGAGGAAGTAATGCTCAAATTCATCTCAATTGTAGCTGTTTCTGAGATTGGTATTTCAATTGTTCCATATTAGATTGTCATCAAATTGATTAACTGAAC
ATGGATGTCAATGCATTTCAATCC