Detailed information on CNT30693645


BLAST search results

BLAST vs Swiss-Prot:
sp|P29409|PGKH_SPIOL, E-value = 1e-48

BLAST vs NONCODE:
NONZMAT003550, E-value = 7e-36

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671212Oryza sativaSetaria viridis39.4122.182.5160forward
CNT30375078Oryza sativaArabidopsis thaliana27.8323.5984.07113forward
CNT30176931Oryza sativaSecale cereale56.6548.5286.96230forward
CNT30236790Oryza sativaBrassica oleracea25.6236.7583.65104forward
CNT30367636Oryza sativaSorghum bicolor28.0839.3192.11114forward
CNT30596272Oryza sativaOryza meridionalis54.4396.09100221forward
CNT30358992Oryza sativaLactuca sativa49.5143.681.09201forward
CNT3032477Oryza sativaTheobroma cacao22.6645.7789.1392forward
CNT30116795Oryza sativaOryza nivara50.4996.24100205forward
CNT30557143Oryza sativaPanicum hallii61.5833.5189.2250forward

Expression of CNT30693645

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MINIEAQNFILFLKEKKGYSKISGLGIAFKNFKHQT*

Sequence

>CNT30693645
CTGTGATTTAAATTAATGATAAACATTGAGGCTCAGAACTTTATATTGTTTTTGAAAGAAAAGAAAGGGTACTCTAAAATTTCTGGTCTAGGTATAGCTT
TCAAAAATTTCAAGCATCAGACTTGAAAATGTAAGGTGAAACGGTAGTAACCTTCTGCAAAAGGAATCCTGCGACAGAAGGCTTTAAAAACTTGGTAACT
CCCTCAGTTGATGCATGTGCTCTGTGGGCTGTTCCGAATGCATCATTGACATAGAGATCTGCTAAGGAGGCAAGCTTCTTGGCAAACTCTGGGTCATTCT
TCTCCTCTTCCTTGTAAAATCTAACATTTTCAAGGAGCAAAACACTACCATTTGGCAATTCAGATACCAATTTCTCAACATCTGGTCCAATAACATCTTC
TGCCTT