Detailed information on CNT30693623


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672463Oryza sativaSetaria viridis14.822.8991.89111forward
CNT30285390Oryza sativaTriticum aestivum11.8724.0592.1389forward
CNT30435028Oryza sativaAegilops tauschii11.8728.6292.1389forward
CNT30655869Oryza sativaTriticum dicoccoides11.8728.5391.0189forward
CNT30367620Oryza sativaSorghum bicolor14.428.0590.74108forward
CNT30604128Oryza sativaOryza punctata2256.993.33165forward

Expression of CNT30693623

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MAIRPWGTSSTVQRICMDGSDQEEGEAETRNLI*

>peptide 2 (37 aa)
MQHRIGSFTTYIAIGIVQLYQHHKQGELIHGDPAMGD*

>peptide 3 (34 aa)
MSRCKIEGRQKIKTEHMGSQYVACSIELDPLQLI*

>peptide 4 (55 aa)
MYLRVVRQSARGDGLTASFLPEMELPARPFTATGWTATRDAIAAVNSREDAKLSR*

>peptide 5 (89 aa)
MSVIRIEHGISGLKPHTPLATAISSASPLLLAYSSYVPAGGAAERPGRRPDGELPAGDGAAGEALHGDRLDGDEGRHCCGEFAGGRKAE*

>peptide 6 (58 aa)
MHAIFSFFTLPHECRDAKSRGDRKLKPNTWDRSTSHAASNWILYNLYSHRNSTIISTS*

Sequence

>CNT30693623
GTAAGTAGTAGTATCAAACTACTAAGGCCGGGTAATCATGCACGCCATTTTCAGTTTTTTCACACTACCACATGAATGTCGAGATGCAAAATCGAGGGGA
GACAGAAAATTAAAACCGAACACATGGGATCGCAGTACGTCGCATGCAGCATCGAATTGGATCCTTTACAACTTATATAGCCATAGGAATAGTACAATTA
TATCAACATCATAAACAGGGGGAATTAATCCATGGCGATCCGGCCATGGGGGACTAGCAGTACAGTACAGAGGATTTGCATGGATGGATCGGATCAAGAA
GAAGGTGAGGCAGAGACGAGGAATTTAATTTAGATCTTGCCGCGTGGGCCGGGCGTCGGCGGCAGCTGCGGGCCCTTCTTGATCGGAAGCAGGTCGAAGT
AGACGCTCTTCTCGCCGTACTTGGCCACCACGGCGGCGCGCGGCCTGTAGCAAAGAAATTATGAGCGTGATAAGAATTGAACACGGGATCTCGGGATTGA
AACCACATACACCTCTTGCCACTGCAATATCAAGTGCATCTCCACTGTTACTCGCGTACTCCTCGTATGTACCTGCGGGTGGTGCGGCAGAGCGCCCGGG
GCGACGGCCTGACGGCGAGCTTCCTGCCGGAGATGGAGCTGCCGGCGAGGCCCTTCACGGCGACAGGCTGGACGGCGACGAGGGACGCCATTGCTGCGGT
GAATTCGCGGGAGGACGCAAAGCTGAGTAGATAGATGGATAGATAGCCGG