Detailed information on CNT30693549


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0DG05|PSAH_ORYSJ, E-value = 3e-30

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30693549

Peptides detected in this lncRNA

>peptide 1 (32 aa)
PNTWDRSTSHAASNWILYNLYSHRNSTIISTS*

>peptide 2 (33 aa)
MAIRPWGTSSTVQRICMDGSDQEEGEAETRNLI*

>peptide 3 (89 aa)
MSVIRIEHGISGLKPHTPLATAISSASPLLLAYSSYVPAGGAAERPGRRPDGELPAGDGAAGEALHGDRLDGDEGRHCCGEFAGGRKAE*

>peptide 4 (55 aa)
MYLRVVRQSARGDGLTASFLPEMELPARPFTATGWTATRDAIAAVNSREDAKLSR*

>peptide 5 (47 aa)
NRTHGIAVRRMQHRIGSFTTYIAIGIVQLYQHHKQGELIHGDPAMGD*

Sequence

>CNT30693549
AACCGAACACATGGGATCGCAGTACGTCGCATGCAGCATCGAATTGGATCCTTTACAACTTATATAGCCATAGGAATAGTACAATTATATCAACATCATA
AACAGGGGGAATTAATCCATGGCGATCCGGCCATGGGGGACTAGCAGTACAGTACAGAGGATTTGCATGGATGGATCGGATCAAGAAGAAGGTGAGGCAG
AGACGAGGAATTTAATTTAGATCTTGCCGCGTGGGCCACCAGCGATCCGCCGCCGAGCAGCAGGAACTTGAGCAGGAGCCCCCTCTTGGTGAAGGGCCCC
GCGAACGTCTCGAAGAACTTGCTCTGCATCGATCACCCACACGAATTATTCAGTAAATTAATCATCGAGCTAAGTATATATTTTAGTCAGGTAATACTAA
CCTGGAGAGGGTTGTACGGCGACGGCGCGTCGGAGCCGTACAGGTCCCACTGCCCGGTGGTGTTGCCGATGTCCTCGAGGTCGAAGTAGACGCTCTTCTC
GCCGTACTTGGCCACCACGGCGGCGCGCGGCCTGTAGCAAAGAAATTATGAGCGTGATAAGAATTGAACACGGGATCTCGGGATTGAAACCACATACACC
TCTTGCCACTGCAATATCAAGTGCATCTCCACTGTTACTCGCGTACTCCTCGTATGTACCTGCGGGTGGTGCGGCAGAGCGCCCGGGGCGACGGCCTGAC
GGCGAGCTTCCTGCCGGAGATGGAGCTGCCGGCGAGGCCCTTCACGGCGACAGGCTGGACGGCGACGAGGGACGCCATTGCTGCGGTGAATTCGCGGGAG
GACGCAAAGCTGAGTAGATAGATGGATAGATAGCCGGTGTACTATCTGCGGCGGCGG