Detailed information on CNT30693530


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553660Oryza sativaOryza glaberrima10053.9499602forward
CNT30370351Oryza sativaOryza glumipatula100.1757.4398.51603forward
CNT30576482Oryza sativaOryza barthii10055.0399.34602forward
CNT30117757Oryza sativaOryza nivara91.3692.9199.64550forward

Expression of CNT30693530

Peptides detected in this lncRNA

>peptide 1 (64 aa)
STAAKLTREVAAGRGSRRTWEGRHRAMGGHRREGCHRHHGRSAREVRSPLGGAPREVVAGGSTL*

>peptide 2 (38 aa)
MATSASSSQCATPPVSSNRREQASQASVDASPTAKQAE*

Sequence

>CNT30693530
CTCCACAGCCGCCAAGCTGACGCGGGAGGTCGCCGCCGGGAGGGGCTCTAGGCGGACATGGGAGGGGCGCCACCGTGCCATGGGAGGTCACCGCCGGGAG
GGGTGCCATAGGCACCACGGGAGGTCCGCGCGGGAGGTCAGGTCGCCGCTGGGAGGGGCGCCACGGGAGGTCGTCGCCGGCGGCTCCACCCTCTAGCCGT
TGTCGCCTCGCCTCCTACCCGTCTGCGCGAGCTCCCCTCCGGCCGGTCATCAACGTCTCCAACCGCGCCTCCCTCCAGTCGCGCCTCCCACCTCCGGTCG
CCACTGCCTCCTCTGTGCCGAGCCGCCGAGCTCCCCTCCGGCCGGCAACGTCCTCCCCTGCGCTGAGCAAGTGATTTGAACCAATGGCTACTTCGGCCAG
TAGCAGCCAGTGTGCTACTCCACCGGTCAGCAGCAACCGGCGTGAGCAAGCCTCACAGGCTTCTGTAGATGCATCCCCAACTGCAAAACAAGCTGAATAG
GAAGAAGAGGAAACTTGTGTAATTGAAGTTTGTTGATTGTGTAATTGTGCTAAAGTATGACATTTGAAGTTGTCTTATTGTTGAACTTATAATGTTTGTA
TT